Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2I1Q5

Protein Details
Accession A0A1Y2I1Q5    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
207-226ASSTKKPAKRWTFGVCRKCSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 7.5, mito 7, cyto 7, nucl 6, pero 3, cysk 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038765  Papain-like_cys_pep_sf  
IPR001394  Peptidase_C19_UCH  
Gene Ontology GO:0004843  F:cysteine-type deubiquitinase activity  
GO:0016579  P:protein deubiquitination  
Pfam View protein in Pfam  
PF00443  UCH  
Amino Acid Sequences MLHELCPAMHVQYPLPDIGILQLWPMGARSEPRQSARHARRHGQGIRGAHEGTVVANIHGPIRCAAPLQGGHGAVCPAVFGVPATRFERAARVLVDGLHEDLNRVKKKPYVEAKDDDGRPDEEVANEQWAGHRARNDSIIVDMFQGQYKSRVQCSVCQGVSLTFDPYMVVTCPFPRHPACTHSTNALTALSPKNIWVQMTPSIAVSASSTKKPAKRWTFGVCRKCS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.17
4 0.14
5 0.14
6 0.14
7 0.1
8 0.08
9 0.09
10 0.08
11 0.08
12 0.09
13 0.08
14 0.08
15 0.12
16 0.17
17 0.24
18 0.3
19 0.34
20 0.37
21 0.42
22 0.52
23 0.58
24 0.63
25 0.62
26 0.63
27 0.65
28 0.72
29 0.7
30 0.65
31 0.62
32 0.55
33 0.52
34 0.48
35 0.41
36 0.32
37 0.27
38 0.21
39 0.15
40 0.14
41 0.11
42 0.08
43 0.09
44 0.09
45 0.11
46 0.11
47 0.12
48 0.1
49 0.11
50 0.11
51 0.11
52 0.11
53 0.13
54 0.13
55 0.15
56 0.16
57 0.15
58 0.15
59 0.15
60 0.14
61 0.1
62 0.1
63 0.07
64 0.04
65 0.04
66 0.04
67 0.03
68 0.06
69 0.07
70 0.11
71 0.12
72 0.13
73 0.14
74 0.15
75 0.18
76 0.17
77 0.18
78 0.15
79 0.14
80 0.14
81 0.13
82 0.14
83 0.11
84 0.11
85 0.1
86 0.09
87 0.08
88 0.11
89 0.18
90 0.2
91 0.2
92 0.21
93 0.23
94 0.25
95 0.33
96 0.4
97 0.39
98 0.42
99 0.44
100 0.46
101 0.49
102 0.48
103 0.4
104 0.32
105 0.26
106 0.22
107 0.2
108 0.16
109 0.1
110 0.11
111 0.11
112 0.1
113 0.09
114 0.09
115 0.08
116 0.11
117 0.12
118 0.13
119 0.15
120 0.16
121 0.17
122 0.19
123 0.19
124 0.16
125 0.15
126 0.14
127 0.12
128 0.11
129 0.1
130 0.09
131 0.1
132 0.1
133 0.09
134 0.12
135 0.16
136 0.17
137 0.18
138 0.23
139 0.23
140 0.28
141 0.34
142 0.38
143 0.34
144 0.32
145 0.31
146 0.26
147 0.28
148 0.23
149 0.18
150 0.11
151 0.11
152 0.11
153 0.1
154 0.11
155 0.08
156 0.09
157 0.08
158 0.11
159 0.15
160 0.16
161 0.21
162 0.22
163 0.26
164 0.28
165 0.33
166 0.35
167 0.36
168 0.37
169 0.37
170 0.36
171 0.32
172 0.3
173 0.25
174 0.2
175 0.2
176 0.21
177 0.18
178 0.17
179 0.17
180 0.21
181 0.22
182 0.23
183 0.19
184 0.2
185 0.24
186 0.26
187 0.25
188 0.21
189 0.2
190 0.19
191 0.17
192 0.15
193 0.17
194 0.18
195 0.2
196 0.24
197 0.31
198 0.36
199 0.44
200 0.53
201 0.56
202 0.59
203 0.65
204 0.7
205 0.74
206 0.79