Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2H9S0

Protein Details
Accession A0A1Y2H9S0   
Localization Confidence High
Confidence Score 19.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MARRSKRSLQVSRQQQKIKDHydrophilic
43-68AGLPPKQEHRSRKARQPPPVKRPLNLHydrophilic
225-252VVSRTLRASPNRKKRNCSKSRLPPGSTCHydrophilic
290-311GSKPPPRCTKRPGGPAASRRSMHydrophilic
NLS Segment(s)
PositionSequence
51-61HRSRKARQPPP
300-300R
Subcellular Location(s) nucl 19, cyto_nucl 13.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MARRSKRSLQVSRQQQKIKDGLRDASTQYGNENGQDYDLRALAGLPPKQEHRSRKARQPPPVKRPLNLVLSSDDEQVADPVAQPGPTKRPRPKQGMTYDENQMPASNGNALLPDSRTNAAPRKTAPPQVLSQLQRKEPRAPTTSKLDAHPLQSTPTCAPTDGAQAPAPSNRRRRHPRLADLPIPRQTSLPETRLLALRSPRLHRAGVPPFRQAGRSLVGGAADTVVSRTLRASPNRKKRNCSKSRLPPGSTCQQAARRLGKSRQPTPCARWRSTFTFNFACAAMGRTGPGSKPPPRCTKRPGGPAASRRSMLRLSPPER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.77
3 0.75
4 0.73
5 0.7
6 0.66
7 0.62
8 0.59
9 0.55
10 0.54
11 0.48
12 0.46
13 0.41
14 0.33
15 0.29
16 0.28
17 0.25
18 0.23
19 0.23
20 0.17
21 0.17
22 0.17
23 0.17
24 0.15
25 0.15
26 0.13
27 0.11
28 0.11
29 0.13
30 0.19
31 0.2
32 0.2
33 0.23
34 0.28
35 0.35
36 0.43
37 0.48
38 0.51
39 0.6
40 0.65
41 0.72
42 0.78
43 0.8
44 0.82
45 0.85
46 0.86
47 0.86
48 0.89
49 0.82
50 0.72
51 0.71
52 0.68
53 0.63
54 0.54
55 0.46
56 0.37
57 0.39
58 0.39
59 0.32
60 0.25
61 0.18
62 0.17
63 0.15
64 0.13
65 0.08
66 0.07
67 0.08
68 0.08
69 0.09
70 0.09
71 0.12
72 0.21
73 0.28
74 0.37
75 0.45
76 0.55
77 0.63
78 0.71
79 0.74
80 0.74
81 0.75
82 0.74
83 0.69
84 0.62
85 0.58
86 0.5
87 0.45
88 0.36
89 0.27
90 0.2
91 0.17
92 0.13
93 0.1
94 0.08
95 0.07
96 0.08
97 0.08
98 0.08
99 0.09
100 0.1
101 0.11
102 0.11
103 0.12
104 0.16
105 0.21
106 0.23
107 0.24
108 0.25
109 0.3
110 0.33
111 0.38
112 0.37
113 0.33
114 0.32
115 0.34
116 0.38
117 0.35
118 0.38
119 0.37
120 0.4
121 0.43
122 0.44
123 0.47
124 0.45
125 0.48
126 0.46
127 0.45
128 0.43
129 0.44
130 0.46
131 0.4
132 0.36
133 0.35
134 0.32
135 0.31
136 0.29
137 0.23
138 0.2
139 0.19
140 0.2
141 0.15
142 0.16
143 0.14
144 0.12
145 0.12
146 0.11
147 0.15
148 0.14
149 0.15
150 0.13
151 0.13
152 0.13
153 0.16
154 0.2
155 0.22
156 0.31
157 0.33
158 0.42
159 0.52
160 0.59
161 0.66
162 0.7
163 0.73
164 0.73
165 0.76
166 0.73
167 0.69
168 0.66
169 0.62
170 0.55
171 0.46
172 0.37
173 0.31
174 0.3
175 0.29
176 0.26
177 0.21
178 0.2
179 0.21
180 0.24
181 0.24
182 0.21
183 0.2
184 0.23
185 0.26
186 0.29
187 0.32
188 0.32
189 0.32
190 0.31
191 0.37
192 0.41
193 0.45
194 0.44
195 0.42
196 0.42
197 0.42
198 0.4
199 0.33
200 0.26
201 0.21
202 0.19
203 0.17
204 0.14
205 0.14
206 0.12
207 0.11
208 0.08
209 0.06
210 0.05
211 0.05
212 0.06
213 0.06
214 0.06
215 0.07
216 0.11
217 0.18
218 0.26
219 0.36
220 0.45
221 0.56
222 0.67
223 0.72
224 0.76
225 0.81
226 0.84
227 0.84
228 0.83
229 0.82
230 0.83
231 0.88
232 0.88
233 0.81
234 0.75
235 0.72
236 0.71
237 0.63
238 0.54
239 0.49
240 0.47
241 0.48
242 0.5
243 0.51
244 0.48
245 0.52
246 0.57
247 0.59
248 0.61
249 0.65
250 0.67
251 0.66
252 0.68
253 0.69
254 0.71
255 0.72
256 0.67
257 0.64
258 0.61
259 0.62
260 0.63
261 0.59
262 0.56
263 0.52
264 0.48
265 0.44
266 0.37
267 0.31
268 0.22
269 0.21
270 0.16
271 0.12
272 0.12
273 0.13
274 0.14
275 0.14
276 0.21
277 0.26
278 0.34
279 0.43
280 0.51
281 0.6
282 0.65
283 0.72
284 0.73
285 0.77
286 0.78
287 0.79
288 0.79
289 0.77
290 0.81
291 0.82
292 0.82
293 0.76
294 0.68
295 0.59
296 0.56
297 0.5
298 0.43
299 0.45