Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2HKD5

Protein Details
Accession A0A1Y2HKD5    Localization Confidence Low Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-31FQFTFEITKRCRRWRRRHTVGVHPFGIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, plas 4, cyto_nucl 3, nucl 2.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MSILFQFTFEITKRCRRWRRRHTVGVHPFGIGIWIIGVGLGRTGTHHDGTTSSHIHASSSSHGRRLLCDTLASWVDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.59
3 0.67
4 0.77
5 0.83
6 0.89
7 0.89
8 0.91
9 0.87
10 0.88
11 0.86
12 0.8
13 0.69
14 0.58
15 0.48
16 0.37
17 0.31
18 0.2
19 0.1
20 0.04
21 0.03
22 0.03
23 0.03
24 0.03
25 0.02
26 0.02
27 0.02
28 0.02
29 0.03
30 0.06
31 0.08
32 0.09
33 0.09
34 0.1
35 0.11
36 0.13
37 0.17
38 0.16
39 0.15
40 0.15
41 0.15
42 0.15
43 0.15
44 0.15
45 0.17
46 0.24
47 0.25
48 0.26
49 0.3
50 0.3
51 0.32
52 0.36
53 0.35
54 0.27
55 0.27
56 0.25
57 0.27