Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2HC02

Protein Details
Accession A0A1Y2HC02   
Localization Confidence Low
Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
53-81QRKWWYIQHACQRKHHQKRQREQEQCRQAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 10, cyto 5.5, mito 5, pero 5
Family & Domain DBs
Amino Acid Sequences MAYSPNLTDEELIHQFLKDVAPFARIKLIHAHLSISPEPHKNVAHFLSKRLIQRKWWYIQHACQRKHHQKRQREQEQCRQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.17
4 0.17
5 0.11
6 0.11
7 0.1
8 0.14
9 0.14
10 0.15
11 0.19
12 0.18
13 0.19
14 0.23
15 0.25
16 0.24
17 0.24
18 0.25
19 0.2
20 0.24
21 0.24
22 0.2
23 0.19
24 0.18
25 0.19
26 0.2
27 0.2
28 0.16
29 0.19
30 0.19
31 0.25
32 0.24
33 0.25
34 0.26
35 0.3
36 0.35
37 0.38
38 0.38
39 0.37
40 0.45
41 0.5
42 0.53
43 0.54
44 0.56
45 0.55
46 0.61
47 0.65
48 0.66
49 0.63
50 0.65
51 0.71
52 0.75
53 0.81
54 0.83
55 0.82
56 0.83
57 0.9
58 0.92
59 0.92
60 0.91
61 0.89