Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2H3W5

Protein Details
Accession A0A1Y2H3W5    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
10-29RSRDGHPKSKPKSSIRRHAHBasic
NLS Segment(s)
PositionSequence
19-21KPK
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MSNDRECQLRSRDGHPKSKPKSSIRRHAHTHAFPPTSTTDHDPRRGSHLPVPRPIARLRRLQLRRCPIQRPQIRHLLNLYQRPRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.66
3 0.71
4 0.69
5 0.75
6 0.76
7 0.75
8 0.79
9 0.79
10 0.81
11 0.79
12 0.8
13 0.77
14 0.75
15 0.74
16 0.67
17 0.63
18 0.59
19 0.51
20 0.44
21 0.4
22 0.35
23 0.28
24 0.26
25 0.25
26 0.25
27 0.27
28 0.33
29 0.32
30 0.3
31 0.36
32 0.37
33 0.35
34 0.34
35 0.39
36 0.38
37 0.41
38 0.46
39 0.41
40 0.41
41 0.44
42 0.45
43 0.42
44 0.45
45 0.44
46 0.5
47 0.56
48 0.61
49 0.66
50 0.67
51 0.72
52 0.7
53 0.73
54 0.7
55 0.73
56 0.73
57 0.71
58 0.68
59 0.69
60 0.65
61 0.62
62 0.58
63 0.57
64 0.57
65 0.58