Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2HGS9

Protein Details
Accession A0A1Y2HGS9    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
6-32LYYHRLDLFKRDKDKLKRWPDLARIDSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, nucl 7.5, cyto_nucl 5.5, mito 3, E.R. 3, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036915  Cyclin-like_sf  
IPR043198  Cyclin/Ssn8  
Gene Ontology GO:0016538  F:cyclin-dependent protein serine/threonine kinase regulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
CDD cd20534  CYCLIN_CCNM_CCNQ_rpt1  
Amino Acid Sequences MATAILYYHRLDLFKRDKDKLKRWPDLARIDSYLFATTCVYLATKATDCPRKVRDIINSANRIMTNRQFLPVDANYWKYRDSLFGAEMTILRILRFDFAVPLAYTLIVDYVLLLFGICNQDGSHPPPRPSPSPLQPPHMSESNLPSPNLVMLSPPSSSSPASPQIMSSTIPHLPPPSSASTDPSTSTYATTPAPPSTLMSSSRIKFKGPMMAMTAAVTASSSSPYPARSHPPLSRSSTSETLSSYNPDSDPDDDSDCEEPLDPIQAYRPPTLPAATPPAARSIVGVAWSIANDAHLRASVNQFVVEDVAVACVYLAIGIVDRQASDERMCHQPHASASDYERPSVETVCTTLGRTCDDAVYKTIEWLLQGELRSRFVDMTASSGPSTTPTTNTLDANHMHTSATVPTPLSIASSSGFLSAPGSTGSYSASSVSPVYEDYHLLGNNSGDKAGASGDAPTSVPDDGVIDPMRAFEAYAQQAGSAAQAARYGGGGRSLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.5
3 0.55
4 0.63
5 0.72
6 0.8
7 0.81
8 0.82
9 0.82
10 0.81
11 0.82
12 0.81
13 0.81
14 0.75
15 0.69
16 0.62
17 0.54
18 0.49
19 0.41
20 0.35
21 0.25
22 0.21
23 0.17
24 0.14
25 0.13
26 0.12
27 0.11
28 0.09
29 0.11
30 0.14
31 0.14
32 0.18
33 0.26
34 0.34
35 0.36
36 0.43
37 0.46
38 0.5
39 0.52
40 0.55
41 0.56
42 0.56
43 0.63
44 0.64
45 0.63
46 0.57
47 0.56
48 0.5
49 0.44
50 0.41
51 0.37
52 0.35
53 0.32
54 0.35
55 0.32
56 0.32
57 0.36
58 0.32
59 0.31
60 0.27
61 0.3
62 0.29
63 0.3
64 0.3
65 0.25
66 0.24
67 0.23
68 0.24
69 0.23
70 0.22
71 0.21
72 0.21
73 0.2
74 0.2
75 0.17
76 0.16
77 0.12
78 0.1
79 0.1
80 0.1
81 0.11
82 0.11
83 0.1
84 0.09
85 0.1
86 0.12
87 0.12
88 0.12
89 0.11
90 0.11
91 0.1
92 0.09
93 0.08
94 0.05
95 0.05
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.03
102 0.05
103 0.08
104 0.07
105 0.08
106 0.08
107 0.11
108 0.14
109 0.19
110 0.26
111 0.28
112 0.31
113 0.36
114 0.42
115 0.43
116 0.46
117 0.49
118 0.49
119 0.56
120 0.57
121 0.58
122 0.56
123 0.55
124 0.54
125 0.49
126 0.42
127 0.34
128 0.36
129 0.37
130 0.36
131 0.33
132 0.28
133 0.25
134 0.24
135 0.22
136 0.16
137 0.09
138 0.08
139 0.1
140 0.1
141 0.1
142 0.11
143 0.12
144 0.13
145 0.13
146 0.16
147 0.2
148 0.21
149 0.2
150 0.19
151 0.19
152 0.2
153 0.2
154 0.16
155 0.15
156 0.15
157 0.16
158 0.16
159 0.16
160 0.15
161 0.16
162 0.18
163 0.17
164 0.19
165 0.19
166 0.22
167 0.22
168 0.23
169 0.23
170 0.21
171 0.2
172 0.17
173 0.17
174 0.14
175 0.14
176 0.13
177 0.14
178 0.14
179 0.13
180 0.13
181 0.12
182 0.13
183 0.13
184 0.15
185 0.14
186 0.17
187 0.21
188 0.22
189 0.28
190 0.28
191 0.26
192 0.26
193 0.27
194 0.3
195 0.26
196 0.26
197 0.22
198 0.22
199 0.22
200 0.2
201 0.18
202 0.1
203 0.09
204 0.07
205 0.05
206 0.04
207 0.05
208 0.04
209 0.05
210 0.06
211 0.08
212 0.1
213 0.13
214 0.18
215 0.21
216 0.27
217 0.29
218 0.32
219 0.36
220 0.39
221 0.39
222 0.36
223 0.36
224 0.34
225 0.31
226 0.29
227 0.25
228 0.2
229 0.19
230 0.18
231 0.14
232 0.12
233 0.11
234 0.12
235 0.12
236 0.11
237 0.13
238 0.12
239 0.13
240 0.12
241 0.14
242 0.14
243 0.12
244 0.11
245 0.1
246 0.08
247 0.07
248 0.09
249 0.07
250 0.06
251 0.08
252 0.11
253 0.13
254 0.15
255 0.15
256 0.15
257 0.16
258 0.17
259 0.16
260 0.14
261 0.18
262 0.18
263 0.18
264 0.17
265 0.19
266 0.18
267 0.18
268 0.16
269 0.11
270 0.1
271 0.1
272 0.09
273 0.07
274 0.07
275 0.07
276 0.07
277 0.05
278 0.06
279 0.05
280 0.05
281 0.05
282 0.06
283 0.07
284 0.08
285 0.1
286 0.11
287 0.11
288 0.11
289 0.11
290 0.11
291 0.1
292 0.09
293 0.07
294 0.05
295 0.05
296 0.04
297 0.04
298 0.04
299 0.03
300 0.03
301 0.03
302 0.03
303 0.02
304 0.02
305 0.03
306 0.04
307 0.04
308 0.04
309 0.06
310 0.07
311 0.08
312 0.09
313 0.1
314 0.13
315 0.2
316 0.21
317 0.21
318 0.21
319 0.22
320 0.23
321 0.26
322 0.25
323 0.2
324 0.22
325 0.29
326 0.29
327 0.27
328 0.26
329 0.23
330 0.22
331 0.21
332 0.19
333 0.11
334 0.11
335 0.13
336 0.13
337 0.13
338 0.14
339 0.14
340 0.15
341 0.15
342 0.15
343 0.15
344 0.16
345 0.16
346 0.16
347 0.19
348 0.17
349 0.16
350 0.17
351 0.15
352 0.13
353 0.13
354 0.13
355 0.12
356 0.13
357 0.17
358 0.17
359 0.19
360 0.2
361 0.19
362 0.18
363 0.15
364 0.17
365 0.12
366 0.16
367 0.15
368 0.16
369 0.15
370 0.15
371 0.15
372 0.14
373 0.18
374 0.14
375 0.15
376 0.17
377 0.21
378 0.23
379 0.24
380 0.23
381 0.23
382 0.24
383 0.26
384 0.24
385 0.21
386 0.19
387 0.18
388 0.18
389 0.16
390 0.16
391 0.13
392 0.12
393 0.12
394 0.12
395 0.12
396 0.12
397 0.1
398 0.1
399 0.09
400 0.1
401 0.1
402 0.1
403 0.1
404 0.09
405 0.1
406 0.08
407 0.09
408 0.08
409 0.09
410 0.08
411 0.08
412 0.09
413 0.09
414 0.1
415 0.1
416 0.1
417 0.1
418 0.11
419 0.11
420 0.1
421 0.1
422 0.13
423 0.12
424 0.13
425 0.13
426 0.17
427 0.17
428 0.17
429 0.17
430 0.16
431 0.19
432 0.18
433 0.17
434 0.13
435 0.12
436 0.12
437 0.11
438 0.11
439 0.07
440 0.08
441 0.09
442 0.1
443 0.1
444 0.1
445 0.11
446 0.11
447 0.1
448 0.09
449 0.11
450 0.1
451 0.15
452 0.15
453 0.14
454 0.14
455 0.14
456 0.15
457 0.13
458 0.13
459 0.1
460 0.17
461 0.19
462 0.2
463 0.2
464 0.18
465 0.19
466 0.19
467 0.17
468 0.13
469 0.1
470 0.1
471 0.11
472 0.11
473 0.11
474 0.12
475 0.13
476 0.1