Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2HT80

Protein Details
Accession A0A1Y2HT80   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
275-296GTGPHDPKKKGKAKAKSRAVAPBasic
NLS Segment(s)
PositionSequence
281-292PKKKGKAKAKSR
356-384DHKRGKASGAARSSGSGKVMGGPRKSGRR
Subcellular Location(s) mito 17.5, cyto_mito 13.333, cyto 8, cyto_nucl 5.333
Family & Domain DBs
Amino Acid Sequences MFATHSAKSVLRPFSVSETCAKCFRGGDDCITPIRAGDLVLSELVRLDSGATLRRFSHLETCVGKAVHHTLPNGKTALATLHPLDHEWYCDRIMRDRTAIEASAFFESDKDARQRKLAAVDFEAIRRAQAEYDARVVSEDGAVRDKKEATEATGKQRQAIVGVDERALWSKALELHQQVTGPKLSKSHPVFGWDVVGPEVLKLRAKQQEEAEKAAAIKAAAEAKVLAEGAAALVGSSAAAGGSAAEATGNVSDADAAGVGKGEQENEEHEKGEEGTGPHDPKKKGKAKAKSRAVAPESAEASTSAVSGRPPVDDESVEPLFEGSDTGRVTRQSKKRAPTPKSATEALETAAKGTADHKRGKASGAARSSGSGKVMGGPRKSGRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.39
3 0.35
4 0.36
5 0.36
6 0.38
7 0.4
8 0.39
9 0.34
10 0.33
11 0.34
12 0.33
13 0.32
14 0.34
15 0.34
16 0.35
17 0.34
18 0.34
19 0.31
20 0.24
21 0.22
22 0.17
23 0.13
24 0.11
25 0.1
26 0.1
27 0.11
28 0.11
29 0.09
30 0.09
31 0.09
32 0.08
33 0.07
34 0.06
35 0.07
36 0.09
37 0.16
38 0.17
39 0.19
40 0.2
41 0.22
42 0.23
43 0.24
44 0.3
45 0.26
46 0.31
47 0.31
48 0.33
49 0.35
50 0.33
51 0.31
52 0.26
53 0.29
54 0.27
55 0.27
56 0.27
57 0.3
58 0.32
59 0.35
60 0.33
61 0.28
62 0.23
63 0.21
64 0.21
65 0.15
66 0.16
67 0.13
68 0.14
69 0.15
70 0.15
71 0.17
72 0.15
73 0.17
74 0.17
75 0.18
76 0.17
77 0.21
78 0.22
79 0.27
80 0.31
81 0.31
82 0.31
83 0.3
84 0.31
85 0.29
86 0.28
87 0.22
88 0.18
89 0.17
90 0.15
91 0.15
92 0.12
93 0.1
94 0.11
95 0.11
96 0.14
97 0.2
98 0.23
99 0.25
100 0.28
101 0.3
102 0.31
103 0.38
104 0.37
105 0.33
106 0.3
107 0.32
108 0.29
109 0.27
110 0.26
111 0.19
112 0.15
113 0.13
114 0.11
115 0.09
116 0.12
117 0.14
118 0.14
119 0.17
120 0.17
121 0.16
122 0.16
123 0.16
124 0.12
125 0.11
126 0.1
127 0.08
128 0.13
129 0.13
130 0.13
131 0.15
132 0.15
133 0.14
134 0.16
135 0.16
136 0.15
137 0.24
138 0.26
139 0.32
140 0.38
141 0.37
142 0.35
143 0.36
144 0.32
145 0.25
146 0.23
147 0.17
148 0.14
149 0.15
150 0.14
151 0.13
152 0.13
153 0.13
154 0.12
155 0.1
156 0.07
157 0.07
158 0.1
159 0.12
160 0.15
161 0.14
162 0.15
163 0.16
164 0.17
165 0.16
166 0.15
167 0.15
168 0.13
169 0.13
170 0.14
171 0.14
172 0.22
173 0.24
174 0.26
175 0.25
176 0.27
177 0.28
178 0.26
179 0.26
180 0.18
181 0.16
182 0.12
183 0.11
184 0.08
185 0.07
186 0.08
187 0.06
188 0.07
189 0.08
190 0.13
191 0.19
192 0.21
193 0.24
194 0.28
195 0.36
196 0.37
197 0.39
198 0.34
199 0.28
200 0.27
201 0.24
202 0.19
203 0.1
204 0.08
205 0.07
206 0.08
207 0.07
208 0.07
209 0.07
210 0.06
211 0.07
212 0.07
213 0.05
214 0.03
215 0.03
216 0.03
217 0.03
218 0.03
219 0.02
220 0.02
221 0.02
222 0.02
223 0.02
224 0.02
225 0.02
226 0.02
227 0.02
228 0.02
229 0.02
230 0.02
231 0.02
232 0.02
233 0.02
234 0.03
235 0.03
236 0.04
237 0.04
238 0.04
239 0.04
240 0.04
241 0.04
242 0.04
243 0.04
244 0.03
245 0.03
246 0.03
247 0.04
248 0.05
249 0.05
250 0.06
251 0.06
252 0.11
253 0.16
254 0.17
255 0.17
256 0.16
257 0.17
258 0.17
259 0.17
260 0.16
261 0.11
262 0.12
263 0.17
264 0.2
265 0.24
266 0.31
267 0.33
268 0.37
269 0.47
270 0.54
271 0.58
272 0.65
273 0.71
274 0.75
275 0.83
276 0.86
277 0.81
278 0.76
279 0.76
280 0.69
281 0.63
282 0.54
283 0.49
284 0.4
285 0.35
286 0.31
287 0.22
288 0.19
289 0.15
290 0.13
291 0.08
292 0.07
293 0.07
294 0.09
295 0.1
296 0.1
297 0.12
298 0.15
299 0.17
300 0.17
301 0.18
302 0.22
303 0.22
304 0.21
305 0.19
306 0.16
307 0.13
308 0.13
309 0.12
310 0.06
311 0.1
312 0.11
313 0.12
314 0.14
315 0.18
316 0.22
317 0.31
318 0.4
319 0.46
320 0.53
321 0.61
322 0.68
323 0.75
324 0.78
325 0.79
326 0.79
327 0.77
328 0.74
329 0.69
330 0.62
331 0.54
332 0.48
333 0.39
334 0.34
335 0.25
336 0.2
337 0.19
338 0.16
339 0.14
340 0.18
341 0.25
342 0.28
343 0.34
344 0.36
345 0.41
346 0.42
347 0.44
348 0.47
349 0.44
350 0.46
351 0.44
352 0.43
353 0.38
354 0.39
355 0.39
356 0.33
357 0.3
358 0.22
359 0.17
360 0.22
361 0.28
362 0.33
363 0.34
364 0.39