FuNGI

A0A1Y2HFJ9

Protein Details

Accession

A0A1Y2HFJ9

Localization Confidence

Low

Confidence Score

9.9

NoLS Segment(s)

Position	Sequence	Protein Nature
54-84	VGNKEALKKRLRDHRRREAERNKANRHRSGG	Basic

NLS Segment(s)

Position	Sequence
59-83	ALKKRLRDHRRREAERNKANRHRSG

Subcellular Location(s)

cyto 10, pero 9, nucl 5, mito 3

Family & Domain DBs

InterPro	View protein in InterPro IPR047201 ERI-1_3'hExo-like IPR013520 Exonuclease_RNaseT/DNA_pol3 IPR012337 RNaseH-like_sf IPR036397 RNaseH_sf IPR003034 SAP_dom IPR036361 SAP_dom_sf
Gene Ontology	GO:0005737 C:cytoplasm GO:0000175 F:3'-5'-RNA exonuclease activity GO:0003676 F:nucleic acid binding GO:0031047 P:RNA-mediated gene silencing
Pfam	View protein in Pfam PF00929 RNase_T PF02037 SAP
PROSITE	View protein in PROSITE PS50800 SAP
CDD	cd06133 ERI-1_3'hExo_like

Amino Acid Sequences

MMSELHPPPLGGTPGSAAEDPDVPFDPTPNPHGLSTLTRAELVAQLEALGLPTVGNKEALKKRLRDHRRREAERNKANRHRSGGNGSGVATKKLGIPTLSADMLDEEPKLDAALADGMDKLSIKAEGTMNGGEQSKAQVADEQEDALSVGPDWILVMDFEATCEPDKAFNYFNEIIEFPCLLLNRHGDFVAEFHSYVRPTLNPKLSEYCSQLTGVTQEQVDAAQTWPTVLHRFEQWLMSRGVVTPDMLDRDNKQKPTQKRREKVLVACDGPWDVRDFARRSCDLHSIPTPFYFTRFLDLRRYVKRTVVNTEAARREAWLRPGADRAVLSPPLTAATLTDVPSPPPSHAASPPPTPTPSGPAPPGNQAPEYSGTGGLDALLAYFGMTFEGRPHCGRDDTRNIARVVQAIIRGGYVVAANWQRVNKSGNRQKQMLVKDAGFTGGRVWEVGDEQWIWQDVYANGSTPKSIRVEAAKRPEGVGNGRH

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.18
2	0.21
3	0.19
4	0.15
5	0.15
6	0.18
7	0.17
8	0.19
9	0.19
10	0.18
11	0.18
12	0.2
13	0.22
14	0.22
15	0.26
16	0.27
17	0.28
18	0.26
19	0.27
20	0.28
21	0.29
22	0.3
23	0.3
24	0.26
25	0.24
26	0.24
27	0.24
28	0.24
29	0.21
30	0.16
31	0.12
32	0.11
33	0.11
34	0.11
35	0.1
36	0.07
37	0.05
38	0.05
39	0.06
40	0.08
41	0.08
42	0.11
43	0.11
44	0.2
45	0.28
46	0.36
47	0.41
48	0.45
49	0.53
50	0.62
51	0.72
52	0.74
53	0.77
54	0.81
55	0.85
56	0.88
57	0.91
58	0.9
59	0.9
60	0.89
61	0.89
62	0.89
63	0.87
64	0.87
65	0.83
66	0.78
67	0.71
68	0.67
69	0.64
70	0.59
71	0.52
72	0.45
73	0.39
74	0.39
75	0.36
76	0.31
77	0.24
78	0.19
79	0.19
80	0.19
81	0.2
82	0.15
83	0.15
84	0.17
85	0.2
86	0.2
87	0.16
88	0.15
89	0.15
90	0.15
91	0.15
92	0.12
93	0.09
94	0.09
95	0.09
96	0.09
97	0.07
98	0.05
99	0.05
100	0.07
101	0.06
102	0.07
103	0.07
104	0.07
105	0.07
106	0.07
107	0.07
108	0.06
109	0.07
110	0.06
111	0.09
112	0.1
113	0.11
114	0.13
115	0.14
116	0.13
117	0.15
118	0.15
119	0.12
120	0.12
121	0.12
122	0.12
123	0.11
124	0.11
125	0.12
126	0.13
127	0.15
128	0.15
129	0.14
130	0.11
131	0.11
132	0.11
133	0.08
134	0.07
135	0.05
136	0.05
137	0.04
138	0.04
139	0.04
140	0.04
141	0.04
142	0.03
143	0.04
144	0.05
145	0.05
146	0.05
147	0.06
148	0.07
149	0.07
150	0.08
151	0.08
152	0.1
153	0.11
154	0.13
155	0.15
156	0.14
157	0.21
158	0.22
159	0.22
160	0.21
161	0.2
162	0.18
163	0.18
164	0.18
165	0.1
166	0.1
167	0.1
168	0.09
169	0.12
170	0.15
171	0.14
172	0.15
173	0.15
174	0.13
175	0.13
176	0.13
177	0.13
178	0.11
179	0.1
180	0.09
181	0.11
182	0.11
183	0.12
184	0.12
185	0.11
186	0.15
187	0.22
188	0.27
189	0.26
190	0.28
191	0.32
192	0.34
193	0.35
194	0.34
195	0.29
196	0.24
197	0.23
198	0.21
199	0.17
200	0.16
201	0.13
202	0.1
203	0.09
204	0.08
205	0.07
206	0.07
207	0.07
208	0.06
209	0.06
210	0.06
211	0.05
212	0.05
213	0.06
214	0.07
215	0.09
216	0.09
217	0.09
218	0.1
219	0.12
220	0.13
221	0.16
222	0.16
223	0.16
224	0.16
225	0.15
226	0.15
227	0.13
228	0.14
229	0.1
230	0.09
231	0.07
232	0.07
233	0.08
234	0.09
235	0.09
236	0.1
237	0.18
238	0.23
239	0.25
240	0.3
241	0.36
242	0.46
243	0.56
244	0.65
245	0.68
246	0.7
247	0.75
248	0.78
249	0.76
250	0.71
251	0.67
252	0.61
253	0.52
254	0.46
255	0.39
256	0.3
257	0.24
258	0.2
259	0.14
260	0.09
261	0.09
262	0.15
263	0.16
264	0.18
265	0.23
266	0.23
267	0.24
268	0.26
269	0.31
270	0.26
271	0.28
272	0.3
273	0.28
274	0.28
275	0.26
276	0.27
277	0.2
278	0.22
279	0.21
280	0.18
281	0.19
282	0.2
283	0.22
284	0.26
285	0.32
286	0.36
287	0.39
288	0.44
289	0.41
290	0.44
291	0.48
292	0.44
293	0.44
294	0.41
295	0.41
296	0.38
297	0.43
298	0.4
299	0.35
300	0.32
301	0.27
302	0.27
303	0.24
304	0.26
305	0.24
306	0.23
307	0.24
308	0.26
309	0.26
310	0.24
311	0.21
312	0.19
313	0.18
314	0.18
315	0.16
316	0.13
317	0.13
318	0.12
319	0.12
320	0.1
321	0.07
322	0.09
323	0.11
324	0.12
325	0.14
326	0.14
327	0.15
328	0.18
329	0.19
330	0.16
331	0.17
332	0.18
333	0.19
334	0.22
335	0.27
336	0.28
337	0.31
338	0.33
339	0.33
340	0.32
341	0.32
342	0.3
343	0.29
344	0.28
345	0.28
346	0.29
347	0.3
348	0.3
349	0.33
350	0.36
351	0.32
352	0.3
353	0.27
354	0.26
355	0.25
356	0.25
357	0.21
358	0.18
359	0.15
360	0.14
361	0.13
362	0.11
363	0.08
364	0.06
365	0.04
366	0.04
367	0.03
368	0.03
369	0.03
370	0.03
371	0.04
372	0.05
373	0.05
374	0.09
375	0.13
376	0.16
377	0.18
378	0.21
379	0.23
380	0.28
381	0.32
382	0.36
383	0.42
384	0.47
385	0.52
386	0.54
387	0.51
388	0.48
389	0.45
390	0.39
391	0.32
392	0.26
393	0.22
394	0.18
395	0.17
396	0.15
397	0.14
398	0.12
399	0.1
400	0.08
401	0.06
402	0.11
403	0.13
404	0.15
405	0.18
406	0.2
407	0.2
408	0.23
409	0.28
410	0.3
411	0.39
412	0.48
413	0.54
414	0.59
415	0.61
416	0.63
417	0.65
418	0.64
419	0.6
420	0.55
421	0.46
422	0.41
423	0.39
424	0.37
425	0.29
426	0.24
427	0.18
428	0.15
429	0.14
430	0.12
431	0.12
432	0.1
433	0.12
434	0.12
435	0.13
436	0.12
437	0.12
438	0.15
439	0.16
440	0.15
441	0.14
442	0.17
443	0.14
444	0.18
445	0.18
446	0.18
447	0.18
448	0.19
449	0.21
450	0.18
451	0.22
452	0.21
453	0.22
454	0.25
455	0.32
456	0.38
457	0.46
458	0.55
459	0.55
460	0.53
461	0.54
462	0.53
463	0.48

A0A1Y2HFJ9

3D AlphaFold-predicted Structure Viewer