Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2A0N6

Protein Details
Accession A0A1Y2A0N6   
Localization Confidence High
Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
6-29NAPSPSPRAPRGKQHQHSKSATQTHydrophilic
31-57LPNGGNQAPRRPRGNRRNNGNNGNNGNHydrophilic
436-459VENPNHRKPRTPGRRAYQPRPDSYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, cyto_nucl 14.5
Family & Domain DBs
Pfam View protein in Pfam  
PF15365  PNRC  
Amino Acid Sequences MSSTNNAPSPSPRAPRGKQHQHSKSATQTQLPNGGNQAPRRPRGNRRNNGNNGNNGNAQQNSAYQSDFSANLGVDDVDSAVVSSEEVPIPTGPRQGKKHTNSQPTADRVFSPTSVAHASLTDSEATPKTASATPAKPQGAYAGPTFHASPAPSALPIPKFLSKSVPAKSRPVPGLPSPPAEVSGSPPSPTPSPPSPSRVPISIPPRNEDSPLDILFKADRAERARVSNLSPASTVFSSPPSHPLANGNIQHAKQDSHSSLNAMFPIELEAPNKAPRRSPPAAAPIAHRSVTAPAGIPQTESFTQPTNNSNVVQDLLGRLNISQEKPLASTPPRVVDRNPSAPSSRHQTPSPFYDGRSAYRSASGPTTPAPTAQETPDFFYGNRNLSPLFKAAKTDSNSKRNSGLRTEITADSPVLQQGGFLPAPPSGPNNIDANIVENPNHRKPRTPGRRAYQPRPDSYPNAGANQRINGAGSGSPVSVPKTTSAMSFIPSSVQTKQHSAKPKSTPLSLEQELKQMLNMKTGPEATQGVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.68
3 0.74
4 0.78
5 0.79
6 0.84
7 0.85
8 0.85
9 0.85
10 0.81
11 0.8
12 0.78
13 0.72
14 0.67
15 0.63
16 0.58
17 0.61
18 0.54
19 0.47
20 0.41
21 0.43
22 0.42
23 0.42
24 0.47
25 0.47
26 0.52
27 0.58
28 0.63
29 0.68
30 0.74
31 0.8
32 0.8
33 0.82
34 0.87
35 0.88
36 0.9
37 0.86
38 0.83
39 0.76
40 0.7
41 0.62
42 0.53
43 0.47
44 0.37
45 0.32
46 0.24
47 0.23
48 0.22
49 0.21
50 0.19
51 0.15
52 0.16
53 0.17
54 0.17
55 0.15
56 0.14
57 0.12
58 0.12
59 0.12
60 0.1
61 0.08
62 0.08
63 0.07
64 0.05
65 0.05
66 0.05
67 0.04
68 0.04
69 0.05
70 0.05
71 0.07
72 0.07
73 0.08
74 0.09
75 0.1
76 0.13
77 0.14
78 0.21
79 0.25
80 0.32
81 0.38
82 0.46
83 0.55
84 0.58
85 0.67
86 0.69
87 0.74
88 0.7
89 0.71
90 0.69
91 0.65
92 0.62
93 0.53
94 0.45
95 0.38
96 0.36
97 0.3
98 0.25
99 0.19
100 0.19
101 0.19
102 0.18
103 0.15
104 0.13
105 0.14
106 0.13
107 0.14
108 0.11
109 0.1
110 0.13
111 0.13
112 0.14
113 0.13
114 0.12
115 0.14
116 0.16
117 0.19
118 0.22
119 0.25
120 0.27
121 0.34
122 0.35
123 0.32
124 0.3
125 0.3
126 0.26
127 0.25
128 0.22
129 0.17
130 0.17
131 0.18
132 0.18
133 0.15
134 0.15
135 0.13
136 0.13
137 0.13
138 0.13
139 0.12
140 0.12
141 0.15
142 0.15
143 0.17
144 0.19
145 0.21
146 0.22
147 0.23
148 0.27
149 0.29
150 0.34
151 0.38
152 0.42
153 0.4
154 0.45
155 0.48
156 0.5
157 0.47
158 0.43
159 0.41
160 0.38
161 0.43
162 0.39
163 0.37
164 0.32
165 0.3
166 0.29
167 0.25
168 0.22
169 0.17
170 0.21
171 0.19
172 0.18
173 0.18
174 0.19
175 0.2
176 0.21
177 0.22
178 0.21
179 0.26
180 0.29
181 0.34
182 0.35
183 0.38
184 0.39
185 0.34
186 0.32
187 0.34
188 0.39
189 0.38
190 0.37
191 0.35
192 0.38
193 0.38
194 0.37
195 0.31
196 0.26
197 0.25
198 0.24
199 0.24
200 0.19
201 0.18
202 0.16
203 0.16
204 0.13
205 0.11
206 0.14
207 0.15
208 0.19
209 0.2
210 0.22
211 0.24
212 0.25
213 0.25
214 0.26
215 0.23
216 0.2
217 0.19
218 0.17
219 0.16
220 0.15
221 0.14
222 0.1
223 0.12
224 0.13
225 0.13
226 0.16
227 0.17
228 0.17
229 0.17
230 0.19
231 0.2
232 0.24
233 0.25
234 0.24
235 0.24
236 0.24
237 0.25
238 0.23
239 0.21
240 0.16
241 0.18
242 0.16
243 0.16
244 0.16
245 0.16
246 0.15
247 0.15
248 0.14
249 0.11
250 0.09
251 0.07
252 0.08
253 0.08
254 0.08
255 0.08
256 0.08
257 0.09
258 0.15
259 0.19
260 0.17
261 0.19
262 0.22
263 0.3
264 0.32
265 0.33
266 0.31
267 0.35
268 0.37
269 0.36
270 0.35
271 0.3
272 0.3
273 0.28
274 0.24
275 0.18
276 0.16
277 0.16
278 0.14
279 0.1
280 0.1
281 0.11
282 0.11
283 0.11
284 0.1
285 0.13
286 0.13
287 0.14
288 0.13
289 0.12
290 0.14
291 0.15
292 0.17
293 0.17
294 0.18
295 0.17
296 0.17
297 0.16
298 0.15
299 0.13
300 0.11
301 0.1
302 0.09
303 0.08
304 0.08
305 0.07
306 0.1
307 0.12
308 0.13
309 0.13
310 0.13
311 0.13
312 0.15
313 0.15
314 0.17
315 0.16
316 0.21
317 0.21
318 0.26
319 0.29
320 0.29
321 0.3
322 0.34
323 0.38
324 0.4
325 0.4
326 0.36
327 0.36
328 0.36
329 0.38
330 0.36
331 0.35
332 0.31
333 0.32
334 0.34
335 0.35
336 0.38
337 0.42
338 0.36
339 0.32
340 0.35
341 0.35
342 0.33
343 0.33
344 0.3
345 0.23
346 0.25
347 0.25
348 0.2
349 0.21
350 0.18
351 0.16
352 0.16
353 0.19
354 0.16
355 0.17
356 0.18
357 0.18
358 0.19
359 0.2
360 0.23
361 0.2
362 0.24
363 0.25
364 0.23
365 0.2
366 0.24
367 0.26
368 0.24
369 0.24
370 0.21
371 0.2
372 0.21
373 0.23
374 0.21
375 0.21
376 0.18
377 0.21
378 0.23
379 0.29
380 0.31
381 0.39
382 0.44
383 0.5
384 0.52
385 0.51
386 0.55
387 0.53
388 0.53
389 0.48
390 0.46
391 0.4
392 0.4
393 0.42
394 0.36
395 0.33
396 0.3
397 0.25
398 0.2
399 0.18
400 0.15
401 0.11
402 0.1
403 0.08
404 0.08
405 0.13
406 0.11
407 0.11
408 0.11
409 0.12
410 0.13
411 0.14
412 0.15
413 0.14
414 0.15
415 0.17
416 0.18
417 0.19
418 0.19
419 0.18
420 0.19
421 0.19
422 0.19
423 0.18
424 0.21
425 0.28
426 0.35
427 0.44
428 0.41
429 0.46
430 0.52
431 0.62
432 0.68
433 0.71
434 0.71
435 0.71
436 0.82
437 0.83
438 0.86
439 0.86
440 0.82
441 0.78
442 0.76
443 0.73
444 0.67
445 0.64
446 0.62
447 0.54
448 0.52
449 0.49
450 0.45
451 0.42
452 0.39
453 0.34
454 0.26
455 0.24
456 0.19
457 0.18
458 0.15
459 0.14
460 0.13
461 0.12
462 0.12
463 0.13
464 0.15
465 0.15
466 0.15
467 0.15
468 0.17
469 0.18
470 0.18
471 0.21
472 0.19
473 0.2
474 0.2
475 0.18
476 0.18
477 0.19
478 0.22
479 0.22
480 0.27
481 0.28
482 0.35
483 0.4
484 0.45
485 0.54
486 0.56
487 0.61
488 0.64
489 0.7
490 0.68
491 0.67
492 0.64
493 0.59
494 0.61
495 0.57
496 0.54
497 0.46
498 0.46
499 0.44
500 0.4
501 0.36
502 0.36
503 0.33
504 0.33
505 0.33
506 0.28
507 0.31
508 0.32
509 0.31
510 0.27