Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1ZUD1

Protein Details
Accession A0A1Y1ZUD1   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MSKRHNRKRTRSRPRHRTRSNHTRNPSVDBasic
NLS Segment(s)
PositionSequence
3-19KRHNRKRTRSRPRHRTR
Subcellular Location(s) nucl 19, mito_nucl 12.333, cyto_nucl 11.833, mito 4.5
Family & Domain DBs
Amino Acid Sequences MSKRHNRKRTRSRPRHRTRSNHTRNPSVDTVSSYSTTNSSFQPPLPFPLANRPVDHWQQTYSAWQTRLRYEEEQAMEAQRLRLFGGEIGDDVSLFEPMLKVVTDLFDGSTDYEDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.97
2 0.97
3 0.95
4 0.94
5 0.93
6 0.93
7 0.93
8 0.91
9 0.86
10 0.83
11 0.75
12 0.71
13 0.64
14 0.55
15 0.45
16 0.38
17 0.34
18 0.28
19 0.27
20 0.2
21 0.18
22 0.16
23 0.16
24 0.15
25 0.14
26 0.15
27 0.15
28 0.17
29 0.2
30 0.2
31 0.22
32 0.24
33 0.23
34 0.2
35 0.28
36 0.32
37 0.29
38 0.29
39 0.29
40 0.31
41 0.33
42 0.35
43 0.26
44 0.22
45 0.21
46 0.21
47 0.21
48 0.19
49 0.19
50 0.19
51 0.22
52 0.22
53 0.24
54 0.26
55 0.27
56 0.26
57 0.24
58 0.28
59 0.26
60 0.25
61 0.23
62 0.22
63 0.19
64 0.17
65 0.17
66 0.12
67 0.12
68 0.11
69 0.1
70 0.1
71 0.1
72 0.1
73 0.09
74 0.08
75 0.09
76 0.08
77 0.08
78 0.08
79 0.07
80 0.06
81 0.06
82 0.06
83 0.05
84 0.05
85 0.06
86 0.06
87 0.06
88 0.06
89 0.08
90 0.09
91 0.09
92 0.1
93 0.09
94 0.1
95 0.1