Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1YHU5

Protein Details
Accession A0A1Y1YHU5    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
12-43IEICRRKDAKSARIKKNKKTNNIKFKVRCQRFHydrophilic
NLS Segment(s)
PositionSequence
17-31RKDAKSARIKKNKKT
Subcellular Location(s) nucl 22, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPSEVSDIKQFIEICRRKDAKSARIKKNKKTNNIKFKVRCQRFIYTLVLKDSDKAEKLKQSLPPGLTITDVGGKNPKGKRSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.43
3 0.45
4 0.42
5 0.5
6 0.55
7 0.54
8 0.6
9 0.67
10 0.68
11 0.76
12 0.83
13 0.83
14 0.86
15 0.85
16 0.84
17 0.85
18 0.85
19 0.85
20 0.85
21 0.85
22 0.79
23 0.8
24 0.81
25 0.73
26 0.7
27 0.63
28 0.6
29 0.53
30 0.52
31 0.46
32 0.39
33 0.37
34 0.31
35 0.28
36 0.24
37 0.22
38 0.21
39 0.19
40 0.18
41 0.19
42 0.21
43 0.24
44 0.27
45 0.31
46 0.34
47 0.37
48 0.41
49 0.39
50 0.39
51 0.35
52 0.32
53 0.28
54 0.23
55 0.19
56 0.19
57 0.19
58 0.17
59 0.22
60 0.23
61 0.3
62 0.35