Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1YES0

Protein Details
Accession A0A1Y1YES0   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
3-28SSAPSLRKPSPRQSRKWLPTRPPGFPHydrophilic
NLS Segment(s)
PositionSequence
17-17R
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MPSSAPSLRKPSPRQSRKWLPTRPPGFPNAQPGARRHMKHYIPHSRLRGPSQLDQQPTTHRPQSSTGIIIVGILRRPCRIYSTVKASTRKALNPRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.78
3 0.83
4 0.83
5 0.86
6 0.85
7 0.82
8 0.83
9 0.81
10 0.76
11 0.69
12 0.63
13 0.58
14 0.52
15 0.51
16 0.45
17 0.43
18 0.4
19 0.38
20 0.42
21 0.44
22 0.42
23 0.38
24 0.42
25 0.42
26 0.46
27 0.53
28 0.56
29 0.53
30 0.59
31 0.58
32 0.54
33 0.53
34 0.49
35 0.45
36 0.38
37 0.38
38 0.38
39 0.39
40 0.36
41 0.35
42 0.34
43 0.34
44 0.34
45 0.35
46 0.33
47 0.29
48 0.29
49 0.31
50 0.34
51 0.3
52 0.28
53 0.24
54 0.19
55 0.18
56 0.17
57 0.14
58 0.11
59 0.11
60 0.12
61 0.13
62 0.15
63 0.17
64 0.18
65 0.22
66 0.25
67 0.3
68 0.35
69 0.43
70 0.5
71 0.55
72 0.6
73 0.58
74 0.62
75 0.6
76 0.6