Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1Y368

Protein Details
Accession A0A1Y1Y368    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
213-233ELPYKRERKELKEENRVLRRLBasic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 10, mito 8, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008555  SIKE  
Pfam View protein in Pfam  
PF05769  SIKE  
Amino Acid Sequences MPRAAPSPSPSQAAAAAAAHQANGIGGNGSSIPMVNGLPSGGQQTDMNHLWSVVQQLSAVLEENRAQTQGIVNGVQAIQARAAEADGGLAGLGVREVNGELNSASRAAEIASLHSQLSNSQTTISDLTTSNTALRGLVSDYESALTLLLDKLRPYAYNQTQAMVALHKHYQTLIEQERAISMQLRLEHAEWQAGLGRVAEYARMALKVQSDGELPYKRERKELKEENRVLRRLAGWEEKKEDSSDEEDQEKIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.16
3 0.15
4 0.14
5 0.14
6 0.12
7 0.1
8 0.09
9 0.08
10 0.08
11 0.07
12 0.05
13 0.05
14 0.06
15 0.06
16 0.07
17 0.06
18 0.06
19 0.06
20 0.06
21 0.07
22 0.06
23 0.06
24 0.06
25 0.06
26 0.07
27 0.09
28 0.08
29 0.1
30 0.1
31 0.11
32 0.17
33 0.18
34 0.19
35 0.17
36 0.17
37 0.16
38 0.16
39 0.17
40 0.12
41 0.11
42 0.09
43 0.09
44 0.1
45 0.1
46 0.1
47 0.07
48 0.08
49 0.09
50 0.11
51 0.12
52 0.11
53 0.11
54 0.1
55 0.12
56 0.12
57 0.12
58 0.11
59 0.1
60 0.11
61 0.1
62 0.11
63 0.1
64 0.09
65 0.08
66 0.07
67 0.07
68 0.06
69 0.07
70 0.05
71 0.04
72 0.04
73 0.03
74 0.03
75 0.03
76 0.02
77 0.02
78 0.02
79 0.02
80 0.02
81 0.02
82 0.02
83 0.03
84 0.04
85 0.04
86 0.05
87 0.05
88 0.06
89 0.06
90 0.06
91 0.06
92 0.05
93 0.05
94 0.05
95 0.06
96 0.06
97 0.08
98 0.09
99 0.09
100 0.09
101 0.1
102 0.09
103 0.09
104 0.12
105 0.1
106 0.09
107 0.09
108 0.09
109 0.1
110 0.11
111 0.1
112 0.09
113 0.08
114 0.09
115 0.09
116 0.09
117 0.08
118 0.08
119 0.08
120 0.06
121 0.06
122 0.06
123 0.05
124 0.06
125 0.07
126 0.06
127 0.06
128 0.07
129 0.07
130 0.06
131 0.06
132 0.05
133 0.04
134 0.05
135 0.06
136 0.06
137 0.06
138 0.07
139 0.08
140 0.09
141 0.12
142 0.21
143 0.23
144 0.3
145 0.3
146 0.3
147 0.29
148 0.29
149 0.26
150 0.18
151 0.15
152 0.1
153 0.12
154 0.11
155 0.11
156 0.11
157 0.12
158 0.12
159 0.19
160 0.2
161 0.2
162 0.2
163 0.2
164 0.2
165 0.19
166 0.19
167 0.13
168 0.1
169 0.11
170 0.12
171 0.14
172 0.15
173 0.15
174 0.18
175 0.17
176 0.17
177 0.14
178 0.14
179 0.15
180 0.14
181 0.13
182 0.11
183 0.1
184 0.1
185 0.1
186 0.1
187 0.07
188 0.08
189 0.08
190 0.09
191 0.09
192 0.1
193 0.12
194 0.13
195 0.14
196 0.14
197 0.14
198 0.15
199 0.21
200 0.24
201 0.25
202 0.33
203 0.39
204 0.39
205 0.48
206 0.52
207 0.54
208 0.6
209 0.68
210 0.69
211 0.73
212 0.8
213 0.81
214 0.83
215 0.77
216 0.67
217 0.6
218 0.52
219 0.45
220 0.44
221 0.44
222 0.42
223 0.46
224 0.5
225 0.49
226 0.49
227 0.46
228 0.41
229 0.35
230 0.35
231 0.34
232 0.32
233 0.31