Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1Y1I4

Protein Details
Accession A0A1Y1Y1I4    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
23-44GLLIARPKPRRNFNPAPHRRYTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 8, cyto_nucl 6.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000550  Hppk  
IPR035907  Hppk_sf  
Gene Ontology GO:0003848  F:2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase activity  
GO:0005524  F:ATP binding  
GO:0004156  F:dihydropteroate synthase activity  
GO:0016301  F:kinase activity  
GO:0046656  P:folic acid biosynthetic process  
GO:0016310  P:phosphorylation  
GO:0046654  P:tetrahydrofolate biosynthetic process  
Pfam View protein in Pfam  
PF01288  HPPK  
PROSITE View protein in PROSITE  
PS00794  HPPK  
CDD cd00483  HPPK  
Amino Acid Sequences MATRTCTRAWTASLLKPSAPDPGLLIARPKPRRNFNPAPHRRYTSSTTRRHFDIAIKPATPVRFRLSKPENVRARRAPTRNLHHATSLPHRAFIALGSNLGDRVAMIDKACKTMELDGSIRILRTSSLWETKAMYVLDQDKFLNGVCEFIEKKMGRVKVVDKGPRNIDLDIVLYDDITYKDERLTIPHALMLERDFVLRPLC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.38
3 0.36
4 0.34
5 0.33
6 0.28
7 0.23
8 0.18
9 0.22
10 0.23
11 0.22
12 0.25
13 0.25
14 0.34
15 0.42
16 0.49
17 0.52
18 0.61
19 0.68
20 0.74
21 0.78
22 0.78
23 0.82
24 0.84
25 0.83
26 0.79
27 0.77
28 0.7
29 0.65
30 0.61
31 0.6
32 0.6
33 0.62
34 0.61
35 0.58
36 0.57
37 0.54
38 0.5
39 0.46
40 0.44
41 0.42
42 0.4
43 0.37
44 0.35
45 0.36
46 0.38
47 0.32
48 0.26
49 0.25
50 0.27
51 0.28
52 0.37
53 0.39
54 0.44
55 0.49
56 0.56
57 0.6
58 0.58
59 0.64
60 0.59
61 0.61
62 0.61
63 0.58
64 0.56
65 0.56
66 0.6
67 0.62
68 0.61
69 0.55
70 0.47
71 0.45
72 0.41
73 0.39
74 0.39
75 0.3
76 0.27
77 0.26
78 0.24
79 0.22
80 0.19
81 0.16
82 0.08
83 0.08
84 0.08
85 0.08
86 0.08
87 0.08
88 0.07
89 0.04
90 0.05
91 0.05
92 0.05
93 0.05
94 0.09
95 0.09
96 0.11
97 0.11
98 0.11
99 0.1
100 0.12
101 0.13
102 0.13
103 0.14
104 0.12
105 0.14
106 0.14
107 0.13
108 0.11
109 0.1
110 0.07
111 0.07
112 0.1
113 0.12
114 0.16
115 0.16
116 0.17
117 0.19
118 0.19
119 0.22
120 0.18
121 0.15
122 0.14
123 0.17
124 0.17
125 0.17
126 0.16
127 0.13
128 0.14
129 0.14
130 0.14
131 0.1
132 0.1
133 0.09
134 0.13
135 0.13
136 0.13
137 0.22
138 0.19
139 0.22
140 0.28
141 0.3
142 0.27
143 0.31
144 0.34
145 0.33
146 0.41
147 0.47
148 0.46
149 0.5
150 0.52
151 0.53
152 0.52
153 0.44
154 0.36
155 0.29
156 0.25
157 0.19
158 0.17
159 0.12
160 0.09
161 0.09
162 0.1
163 0.09
164 0.1
165 0.1
166 0.1
167 0.11
168 0.13
169 0.14
170 0.17
171 0.21
172 0.21
173 0.21
174 0.22
175 0.22
176 0.21
177 0.22
178 0.19
179 0.17
180 0.15
181 0.15
182 0.14