Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2A3A3

Protein Details
Accession A0A1Y2A3A3    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
18-37LACTRLRKKRTIKGNRAVPEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MTCAAAQLLKSWLVHALLACTRLRKKRTIKGNRAVPEDITRDPIFRASPEPLRNLKEPTMYVGKAASSAGQSDMDSRPRCGFMNDSSTTANWSSSAPASP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.15
4 0.14
5 0.17
6 0.17
7 0.21
8 0.27
9 0.34
10 0.38
11 0.44
12 0.51
13 0.57
14 0.67
15 0.73
16 0.76
17 0.78
18 0.83
19 0.79
20 0.75
21 0.67
22 0.58
23 0.51
24 0.44
25 0.35
26 0.31
27 0.25
28 0.21
29 0.2
30 0.2
31 0.16
32 0.13
33 0.15
34 0.14
35 0.19
36 0.2
37 0.24
38 0.26
39 0.29
40 0.3
41 0.31
42 0.29
43 0.26
44 0.24
45 0.23
46 0.24
47 0.21
48 0.19
49 0.17
50 0.15
51 0.13
52 0.13
53 0.1
54 0.06
55 0.07
56 0.08
57 0.08
58 0.08
59 0.11
60 0.14
61 0.2
62 0.21
63 0.24
64 0.24
65 0.26
66 0.26
67 0.26
68 0.27
69 0.25
70 0.31
71 0.3
72 0.3
73 0.3
74 0.29
75 0.3
76 0.27
77 0.23
78 0.16
79 0.15
80 0.15