Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1ZVL0

Protein Details
Accession A0A1Y1ZVL0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
58-87MQIPQRQPCKNERHKTRPGPTTQKIPKRRVHydrophilic
NLS Segment(s)
PositionSequence
83-85PKR
Subcellular Location(s) mito 9, plas 5, mito_nucl 5, E.R. 4, pero 3
Family & Domain DBs
Amino Acid Sequences MIKLRIIVCVNCSSLVIITSSSRYISSPPFLPPHNIIHNNDDKYYHIPIISTVAQSIMQIPQRQPCKNERHKTRPGPTTQKIPKRRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.12
4 0.09
5 0.09
6 0.1
7 0.11
8 0.11
9 0.11
10 0.11
11 0.12
12 0.14
13 0.16
14 0.17
15 0.19
16 0.21
17 0.22
18 0.25
19 0.25
20 0.28
21 0.32
22 0.34
23 0.33
24 0.36
25 0.41
26 0.39
27 0.36
28 0.32
29 0.26
30 0.24
31 0.24
32 0.19
33 0.12
34 0.11
35 0.11
36 0.14
37 0.13
38 0.11
39 0.09
40 0.09
41 0.09
42 0.09
43 0.1
44 0.1
45 0.13
46 0.15
47 0.17
48 0.23
49 0.3
50 0.33
51 0.36
52 0.42
53 0.49
54 0.58
55 0.67
56 0.7
57 0.73
58 0.81
59 0.87
60 0.88
61 0.85
62 0.84
63 0.84
64 0.79
65 0.8
66 0.8
67 0.8