Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1YP42

Protein Details
Accession A0A1Y1YP42   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-31LVIACKPLTRQPRRKVRRSQSDILSHYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 10.5, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences LKKQLVIACKPLTRQPRRKVRRSQSDILSHYKQKKANNVYLEVLNKDPHLFLPFILAISPSACRTFNASKLCQRLKQEHPIQLQNNAKIVLNNIANKNSIIRSPYYKKLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.66
3 0.72
4 0.79
5 0.86
6 0.89
7 0.89
8 0.9
9 0.88
10 0.85
11 0.82
12 0.81
13 0.75
14 0.71
15 0.65
16 0.61
17 0.59
18 0.57
19 0.53
20 0.49
21 0.55
22 0.55
23 0.57
24 0.53
25 0.5
26 0.46
27 0.45
28 0.42
29 0.34
30 0.28
31 0.21
32 0.18
33 0.15
34 0.13
35 0.11
36 0.11
37 0.09
38 0.08
39 0.1
40 0.1
41 0.09
42 0.09
43 0.08
44 0.06
45 0.07
46 0.08
47 0.06
48 0.07
49 0.08
50 0.08
51 0.14
52 0.16
53 0.22
54 0.27
55 0.29
56 0.34
57 0.41
58 0.45
59 0.44
60 0.46
61 0.48
62 0.49
63 0.56
64 0.57
65 0.57
66 0.58
67 0.62
68 0.59
69 0.59
70 0.59
71 0.51
72 0.46
73 0.4
74 0.35
75 0.28
76 0.28
77 0.25
78 0.24
79 0.27
80 0.27
81 0.28
82 0.29
83 0.29
84 0.3
85 0.26
86 0.24
87 0.22
88 0.23
89 0.3
90 0.35