Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8PN79

Protein Details
Accession B8PN79    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
28-54SPSPPTRDTTTRRRRSRPWRATGPLAPHydrophilic
NLS Segment(s)
PositionSequence
22-81RARRPPSPSPPTRDTTTRRRRSRPWRATGPLAPGSAPSPSRRSARSPHSRASAARRLLPG
Subcellular Location(s) mito 12, extr 11, cyto 2
Family & Domain DBs
KEGG ppl:POSPLDRAFT_98155  -  
Amino Acid Sequences MRVFAVITALSARSTLSAPAARARRPPSPSPPTRDTTTRRRRSRPWRATGPLAPGSAPSPSRRSARSPHSRASAARRLLPGGTRPRAGTCGEPAYARCTVAVLVTDHAGAGLNIPVEAFDQRHGGTAARRSTSPASTPRRRTSTPRGAAVRPVLLSLRAYVHPWRIIACPTRTCATRMAQAGGGGSACAWDQGLPRSESNVVAAELPPLLGDKQRWCLRGLKLFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.13
4 0.15
5 0.17
6 0.24
7 0.29
8 0.31
9 0.38
10 0.42
11 0.45
12 0.49
13 0.55
14 0.58
15 0.63
16 0.68
17 0.68
18 0.69
19 0.66
20 0.65
21 0.66
22 0.62
23 0.63
24 0.67
25 0.69
26 0.72
27 0.75
28 0.81
29 0.84
30 0.88
31 0.88
32 0.86
33 0.85
34 0.82
35 0.81
36 0.74
37 0.7
38 0.62
39 0.51
40 0.42
41 0.33
42 0.28
43 0.24
44 0.21
45 0.18
46 0.18
47 0.22
48 0.25
49 0.27
50 0.32
51 0.36
52 0.45
53 0.52
54 0.54
55 0.56
56 0.57
57 0.57
58 0.55
59 0.56
60 0.54
61 0.45
62 0.43
63 0.39
64 0.35
65 0.33
66 0.31
67 0.3
68 0.3
69 0.3
70 0.28
71 0.28
72 0.28
73 0.29
74 0.29
75 0.24
76 0.18
77 0.18
78 0.17
79 0.17
80 0.17
81 0.18
82 0.17
83 0.15
84 0.12
85 0.1
86 0.09
87 0.09
88 0.1
89 0.07
90 0.06
91 0.07
92 0.07
93 0.06
94 0.06
95 0.05
96 0.04
97 0.04
98 0.04
99 0.03
100 0.03
101 0.03
102 0.03
103 0.04
104 0.05
105 0.05
106 0.05
107 0.07
108 0.07
109 0.08
110 0.09
111 0.09
112 0.11
113 0.16
114 0.18
115 0.18
116 0.18
117 0.2
118 0.22
119 0.23
120 0.24
121 0.28
122 0.34
123 0.42
124 0.49
125 0.52
126 0.56
127 0.58
128 0.61
129 0.63
130 0.64
131 0.61
132 0.61
133 0.58
134 0.53
135 0.54
136 0.49
137 0.4
138 0.29
139 0.25
140 0.18
141 0.15
142 0.15
143 0.12
144 0.12
145 0.11
146 0.13
147 0.15
148 0.19
149 0.19
150 0.19
151 0.2
152 0.19
153 0.23
154 0.27
155 0.29
156 0.28
157 0.29
158 0.32
159 0.32
160 0.32
161 0.32
162 0.29
163 0.31
164 0.3
165 0.29
166 0.27
167 0.26
168 0.25
169 0.2
170 0.17
171 0.11
172 0.08
173 0.06
174 0.05
175 0.05
176 0.05
177 0.06
178 0.08
179 0.13
180 0.17
181 0.2
182 0.2
183 0.24
184 0.25
185 0.24
186 0.24
187 0.21
188 0.17
189 0.16
190 0.16
191 0.13
192 0.12
193 0.11
194 0.09
195 0.09
196 0.09
197 0.12
198 0.16
199 0.2
200 0.29
201 0.36
202 0.37
203 0.38
204 0.44
205 0.49