Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8PN72

Protein Details
Accession B8PN72    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
44-88DEPDVKGLKHRREINKKTRSGEKKIRRTLKSFKSKQKRKADAFTPBasic
NLS Segment(s)
PositionSequence
50-82GLKHRREINKKTRSGEKKIRRTLKSFKSKQKRK
260-260R
Subcellular Location(s) cyto_nucl 13.5, nucl 13, cyto 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR027312  Sda1  
IPR007949  SDA1_C  
Gene Ontology GO:0005730  C:nucleolus  
GO:0015031  P:protein transport  
GO:0042273  P:ribosomal large subunit biogenesis  
GO:0000055  P:ribosomal large subunit export from nucleus  
KEGG ppl:POSPLDRAFT_27696  -  
Pfam View protein in Pfam  
PF05285  SDA1  
Amino Acid Sequences NDAKTVSIVALGCFHPVTKVQSASLHFFLGSDEENDDSDDEEEDEPDVKGLKHRREINKKTRSGEKKIRRTLKSFKSKQKRKADAFTPNFPAIQLLNDPQTFGEKLYDNLNRYDKRFSLDHKILLMQLLARVMGAHKLCVLGFYTYIMKYLTYHQLRIPAILVALAQSVHDLTPPDALTPVVRKLAQEFVHPGVGSEVIAAGMNAIREVCRRQPWAMEEDLLGDLVEYQKSRDKAVTAAARGLLQLFREVNPGMLKRRQRGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.15
4 0.2
5 0.22
6 0.24
7 0.24
8 0.29
9 0.33
10 0.36
11 0.35
12 0.3
13 0.25
14 0.23
15 0.21
16 0.18
17 0.16
18 0.12
19 0.11
20 0.12
21 0.12
22 0.13
23 0.12
24 0.11
25 0.11
26 0.1
27 0.11
28 0.1
29 0.1
30 0.1
31 0.11
32 0.1
33 0.1
34 0.1
35 0.09
36 0.16
37 0.23
38 0.3
39 0.37
40 0.46
41 0.56
42 0.66
43 0.76
44 0.8
45 0.82
46 0.82
47 0.79
48 0.8
49 0.78
50 0.76
51 0.77
52 0.76
53 0.77
54 0.8
55 0.85
56 0.79
57 0.79
58 0.79
59 0.79
60 0.79
61 0.78
62 0.79
63 0.8
64 0.85
65 0.88
66 0.89
67 0.88
68 0.84
69 0.82
70 0.79
71 0.79
72 0.75
73 0.7
74 0.64
75 0.55
76 0.48
77 0.4
78 0.33
79 0.22
80 0.18
81 0.14
82 0.1
83 0.13
84 0.13
85 0.13
86 0.12
87 0.14
88 0.13
89 0.12
90 0.13
91 0.1
92 0.11
93 0.17
94 0.2
95 0.19
96 0.23
97 0.29
98 0.29
99 0.3
100 0.33
101 0.28
102 0.27
103 0.28
104 0.28
105 0.3
106 0.31
107 0.3
108 0.27
109 0.27
110 0.24
111 0.22
112 0.19
113 0.1
114 0.08
115 0.06
116 0.05
117 0.04
118 0.04
119 0.04
120 0.08
121 0.07
122 0.07
123 0.07
124 0.08
125 0.08
126 0.08
127 0.09
128 0.06
129 0.06
130 0.07
131 0.09
132 0.08
133 0.09
134 0.09
135 0.08
136 0.08
137 0.11
138 0.19
139 0.19
140 0.21
141 0.21
142 0.27
143 0.27
144 0.26
145 0.24
146 0.15
147 0.13
148 0.12
149 0.11
150 0.05
151 0.05
152 0.05
153 0.04
154 0.04
155 0.04
156 0.04
157 0.05
158 0.06
159 0.06
160 0.09
161 0.09
162 0.09
163 0.09
164 0.09
165 0.1
166 0.12
167 0.14
168 0.14
169 0.14
170 0.14
171 0.16
172 0.23
173 0.22
174 0.22
175 0.24
176 0.23
177 0.26
178 0.25
179 0.23
180 0.17
181 0.16
182 0.13
183 0.1
184 0.07
185 0.05
186 0.05
187 0.05
188 0.04
189 0.04
190 0.04
191 0.05
192 0.05
193 0.05
194 0.08
195 0.12
196 0.18
197 0.23
198 0.27
199 0.29
200 0.34
201 0.37
202 0.4
203 0.38
204 0.33
205 0.27
206 0.25
207 0.23
208 0.18
209 0.14
210 0.09
211 0.08
212 0.08
213 0.1
214 0.08
215 0.1
216 0.16
217 0.18
218 0.2
219 0.22
220 0.22
221 0.23
222 0.31
223 0.36
224 0.32
225 0.33
226 0.32
227 0.29
228 0.28
229 0.28
230 0.21
231 0.14
232 0.17
233 0.16
234 0.15
235 0.19
236 0.19
237 0.2
238 0.25
239 0.28
240 0.31
241 0.38
242 0.45