Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8PMT6

Protein Details
Accession B8PMT6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
79-100DVEAKKRRGKGAPKKAKSKGAYBasic
NLS Segment(s)
PositionSequence
83-97KKRRGKGAPKKAKSK
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG ppl:POSPLDRAFT_104402  -  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MAAIAPSRLATLTRLRCSIFQTSYNPTSIRTGAKYLRARLRGPSMVEYYPPEVSIAQFNRMSGGDWRIVDPQEDMRLADVEAKKRRGKGAPKKAKSKGAYIVQLLGYGICTSGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.35
4 0.39
5 0.42
6 0.37
7 0.33
8 0.34
9 0.39
10 0.39
11 0.4
12 0.36
13 0.31
14 0.3
15 0.28
16 0.27
17 0.22
18 0.24
19 0.25
20 0.33
21 0.36
22 0.4
23 0.45
24 0.46
25 0.45
26 0.44
27 0.47
28 0.41
29 0.39
30 0.36
31 0.32
32 0.28
33 0.28
34 0.25
35 0.21
36 0.18
37 0.16
38 0.13
39 0.1
40 0.1
41 0.14
42 0.13
43 0.15
44 0.15
45 0.14
46 0.15
47 0.15
48 0.15
49 0.12
50 0.13
51 0.12
52 0.12
53 0.14
54 0.15
55 0.15
56 0.14
57 0.14
58 0.13
59 0.13
60 0.13
61 0.12
62 0.11
63 0.11
64 0.11
65 0.16
66 0.17
67 0.23
68 0.29
69 0.35
70 0.38
71 0.4
72 0.46
73 0.48
74 0.56
75 0.59
76 0.65
77 0.7
78 0.75
79 0.82
80 0.84
81 0.85
82 0.77
83 0.72
84 0.69
85 0.66
86 0.62
87 0.54
88 0.5
89 0.41
90 0.38
91 0.31
92 0.23
93 0.16
94 0.11