Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1Y0R7

Protein Details
Accession A0A1Y1Y0R7   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPISKKDRIQREHKKADKAGBasic
NLS Segment(s)
PositionSequence
8-24RIQREHKKADKAGTRAP
Subcellular Location(s) nucl 15, mito_nucl 11.333, cyto_nucl 9.833, mito 6.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR026939  ZNF706/At2g23090_sf  
Amino Acid Sequences MPISKKDRIQREHKKADKAGTRAPVKANGLPVKAPKPTSICQNCRREMVNTNKVQLEAHALTHDQKMWPKEKCWPEVYPSDGAAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.78
3 0.79
4 0.76
5 0.7
6 0.65
7 0.63
8 0.59
9 0.53
10 0.5
11 0.46
12 0.42
13 0.38
14 0.39
15 0.33
16 0.31
17 0.3
18 0.32
19 0.3
20 0.29
21 0.28
22 0.24
23 0.26
24 0.26
25 0.34
26 0.39
27 0.43
28 0.5
29 0.55
30 0.54
31 0.51
32 0.52
33 0.44
34 0.44
35 0.46
36 0.46
37 0.41
38 0.42
39 0.4
40 0.39
41 0.36
42 0.28
43 0.25
44 0.16
45 0.15
46 0.14
47 0.14
48 0.16
49 0.17
50 0.18
51 0.15
52 0.19
53 0.24
54 0.3
55 0.34
56 0.34
57 0.43
58 0.49
59 0.52
60 0.53
61 0.5
62 0.49
63 0.51
64 0.53
65 0.47