Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1YRS9

Protein Details
Accession A0A1Y1YRS9    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
118-137GQKPRRKHSLRTGKSPMQKYBasic
NLS Segment(s)
Subcellular Location(s) mito 12.5, mito_nucl 11.333, nucl 9, cyto_nucl 7.833, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009027  Ribosomal_L9/RNase_H1_N  
IPR011320  RNase_H1_N  
IPR037056  RNase_H1_N_sf  
Pfam View protein in Pfam  
PF01693  Cauli_VI  
Amino Acid Sequences MVRRKNKEYYAVFQGRVDEPTIFSSWGDAHPRAIGGCSSQHSAFVTIKEAREYMMKKGTSTCKEVIKSTTDTTPEEDSMGFMMSQMERILAFARPGTGKREHLKTLISSTMFVTSGFGQKPRRKHSLRTGKSPMQKYGVWK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.41
3 0.36
4 0.32
5 0.22
6 0.18
7 0.2
8 0.2
9 0.17
10 0.15
11 0.15
12 0.14
13 0.18
14 0.21
15 0.18
16 0.18
17 0.18
18 0.18
19 0.17
20 0.17
21 0.13
22 0.1
23 0.12
24 0.13
25 0.15
26 0.15
27 0.16
28 0.16
29 0.18
30 0.18
31 0.16
32 0.18
33 0.17
34 0.18
35 0.18
36 0.17
37 0.15
38 0.19
39 0.2
40 0.19
41 0.24
42 0.23
43 0.23
44 0.28
45 0.35
46 0.33
47 0.35
48 0.34
49 0.32
50 0.33
51 0.34
52 0.31
53 0.27
54 0.27
55 0.24
56 0.23
57 0.2
58 0.19
59 0.2
60 0.2
61 0.17
62 0.15
63 0.13
64 0.11
65 0.09
66 0.09
67 0.06
68 0.05
69 0.06
70 0.05
71 0.06
72 0.06
73 0.05
74 0.05
75 0.06
76 0.07
77 0.06
78 0.07
79 0.06
80 0.08
81 0.1
82 0.11
83 0.15
84 0.19
85 0.24
86 0.29
87 0.34
88 0.34
89 0.35
90 0.36
91 0.33
92 0.33
93 0.32
94 0.27
95 0.23
96 0.21
97 0.21
98 0.19
99 0.16
100 0.15
101 0.12
102 0.16
103 0.17
104 0.21
105 0.28
106 0.34
107 0.43
108 0.49
109 0.58
110 0.58
111 0.65
112 0.72
113 0.74
114 0.76
115 0.77
116 0.79
117 0.77
118 0.82
119 0.78
120 0.73
121 0.66