Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8P5K2

Protein Details
Accession B8P5K2    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
13-43RAELRVSVAHRRRCRRTSKAKSKCWETESKCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto 8, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
KEGG ppl:POSPLDRAFT_102987  -  
Amino Acid Sequences MFRDLRTRHREDRAELRVSVAHRRRCRRTSKAKSKCWETESKCRAGCECRKEVNRGPEGLGAYHRLDILAPEPFSGKVEDLRCFLQCILSYFVATNNTRLSNEAKIAFTVALMRKDLGKTWADAYYEKSAGGVQAHQILMKLPERQKNKKTAPSLGNYVTRFEQLASKAQLKDAEVNGVNRTENDYHTLHANFVKGLPKELYVSLATRVARDRPNTMKAWYDEVRNADAAEQGALTVTDTRDYGEPMDIDAAAVAATFSSTSGGRKWELGAVLNEADWKLHRDGNLCFYCHIKGHSAKDCCKKAAARQGGGGPNQGGSGKDDFRARIKTLSADEKRELYEELTMEDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.6
3 0.54
4 0.48
5 0.45
6 0.49
7 0.47
8 0.49
9 0.54
10 0.63
11 0.7
12 0.75
13 0.82
14 0.83
15 0.86
16 0.87
17 0.89
18 0.9
19 0.9
20 0.91
21 0.9
22 0.87
23 0.82
24 0.81
25 0.77
26 0.78
27 0.75
28 0.74
29 0.66
30 0.61
31 0.58
32 0.57
33 0.59
34 0.56
35 0.57
36 0.59
37 0.61
38 0.67
39 0.71
40 0.71
41 0.67
42 0.6
43 0.54
44 0.49
45 0.45
46 0.38
47 0.32
48 0.26
49 0.22
50 0.2
51 0.18
52 0.14
53 0.13
54 0.13
55 0.13
56 0.14
57 0.13
58 0.13
59 0.14
60 0.14
61 0.15
62 0.15
63 0.14
64 0.16
65 0.19
66 0.2
67 0.21
68 0.23
69 0.22
70 0.23
71 0.22
72 0.19
73 0.17
74 0.18
75 0.21
76 0.19
77 0.19
78 0.18
79 0.19
80 0.22
81 0.21
82 0.2
83 0.18
84 0.19
85 0.19
86 0.2
87 0.21
88 0.19
89 0.21
90 0.21
91 0.19
92 0.18
93 0.18
94 0.16
95 0.14
96 0.16
97 0.16
98 0.15
99 0.15
100 0.16
101 0.17
102 0.17
103 0.19
104 0.17
105 0.15
106 0.15
107 0.16
108 0.19
109 0.18
110 0.18
111 0.21
112 0.21
113 0.2
114 0.19
115 0.17
116 0.14
117 0.14
118 0.14
119 0.1
120 0.07
121 0.1
122 0.1
123 0.1
124 0.1
125 0.1
126 0.12
127 0.13
128 0.18
129 0.21
130 0.28
131 0.35
132 0.44
133 0.49
134 0.56
135 0.61
136 0.63
137 0.62
138 0.63
139 0.6
140 0.56
141 0.54
142 0.48
143 0.46
144 0.38
145 0.36
146 0.29
147 0.24
148 0.21
149 0.17
150 0.16
151 0.12
152 0.16
153 0.17
154 0.2
155 0.2
156 0.21
157 0.21
158 0.19
159 0.21
160 0.17
161 0.17
162 0.15
163 0.16
164 0.16
165 0.15
166 0.14
167 0.11
168 0.14
169 0.12
170 0.11
171 0.14
172 0.14
173 0.14
174 0.17
175 0.17
176 0.15
177 0.15
178 0.15
179 0.11
180 0.12
181 0.17
182 0.14
183 0.16
184 0.15
185 0.15
186 0.16
187 0.16
188 0.16
189 0.12
190 0.13
191 0.12
192 0.14
193 0.14
194 0.14
195 0.15
196 0.17
197 0.21
198 0.22
199 0.27
200 0.28
201 0.33
202 0.34
203 0.34
204 0.34
205 0.32
206 0.36
207 0.32
208 0.29
209 0.27
210 0.28
211 0.28
212 0.23
213 0.22
214 0.16
215 0.15
216 0.13
217 0.1
218 0.07
219 0.06
220 0.05
221 0.05
222 0.05
223 0.06
224 0.06
225 0.06
226 0.06
227 0.08
228 0.08
229 0.09
230 0.1
231 0.1
232 0.1
233 0.1
234 0.11
235 0.09
236 0.08
237 0.07
238 0.06
239 0.04
240 0.04
241 0.03
242 0.02
243 0.02
244 0.03
245 0.03
246 0.04
247 0.05
248 0.07
249 0.08
250 0.11
251 0.12
252 0.13
253 0.14
254 0.16
255 0.17
256 0.18
257 0.18
258 0.18
259 0.17
260 0.16
261 0.16
262 0.13
263 0.13
264 0.11
265 0.14
266 0.14
267 0.16
268 0.18
269 0.2
270 0.23
271 0.32
272 0.34
273 0.31
274 0.3
275 0.3
276 0.3
277 0.29
278 0.28
279 0.26
280 0.29
281 0.36
282 0.44
283 0.49
284 0.55
285 0.63
286 0.65
287 0.61
288 0.6
289 0.57
290 0.57
291 0.6
292 0.61
293 0.53
294 0.52
295 0.57
296 0.57
297 0.54
298 0.48
299 0.37
300 0.29
301 0.28
302 0.24
303 0.18
304 0.16
305 0.2
306 0.18
307 0.21
308 0.24
309 0.26
310 0.31
311 0.36
312 0.35
313 0.34
314 0.35
315 0.37
316 0.39
317 0.47
318 0.47
319 0.48
320 0.49
321 0.48
322 0.47
323 0.44
324 0.39
325 0.3
326 0.29
327 0.23