Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2A5W9

Protein Details
Accession A0A1Y2A5W9    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
103-123PKDESQKKDERQQIKRNPDGTHydrophilic
NLS Segment(s)
PositionSequence
90-97HGKKREGK
Subcellular Location(s) cyto_nucl 14, cyto 11.5, nucl 9.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011893  Selenoprotein_Rdx-typ  
IPR036249  Thioredoxin-like_sf  
Pfam View protein in Pfam  
PF10262  Rdx  
Amino Acid Sequences MSMDFGQELLSTFGTQIGEVALIPATGGLFQVELTYSPPEAAQEGQSLIVKKALLWDRKEKGGFPETKILKQLVRDHIDPNKDLGHSDKHGKKREGKGTQGEPKDESQKKDERQQIKRNPDGTICEDCN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.09
4 0.08
5 0.07
6 0.07
7 0.07
8 0.05
9 0.05
10 0.05
11 0.04
12 0.04
13 0.04
14 0.04
15 0.04
16 0.04
17 0.04
18 0.04
19 0.04
20 0.05
21 0.07
22 0.08
23 0.08
24 0.08
25 0.08
26 0.08
27 0.09
28 0.1
29 0.09
30 0.08
31 0.09
32 0.1
33 0.11
34 0.12
35 0.11
36 0.12
37 0.11
38 0.1
39 0.16
40 0.21
41 0.24
42 0.27
43 0.34
44 0.35
45 0.4
46 0.4
47 0.35
48 0.33
49 0.35
50 0.33
51 0.28
52 0.34
53 0.31
54 0.31
55 0.32
56 0.29
57 0.23
58 0.26
59 0.3
60 0.29
61 0.31
62 0.31
63 0.33
64 0.37
65 0.38
66 0.34
67 0.3
68 0.25
69 0.21
70 0.2
71 0.19
72 0.19
73 0.2
74 0.28
75 0.33
76 0.4
77 0.48
78 0.53
79 0.59
80 0.64
81 0.71
82 0.69
83 0.69
84 0.69
85 0.7
86 0.73
87 0.68
88 0.61
89 0.54
90 0.51
91 0.54
92 0.51
93 0.46
94 0.44
95 0.49
96 0.52
97 0.59
98 0.64
99 0.64
100 0.69
101 0.76
102 0.79
103 0.8
104 0.83
105 0.76
106 0.71
107 0.65
108 0.61
109 0.56