Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2A594

Protein Details
Accession A0A1Y2A594    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-23AKGLRSSVKKANRTKLRSRVFGHydrophilic
91-124AATSAKSTKKRVHRSKLNRRRKPRNQITFPQSRGHydrophilic
NLS Segment(s)
PositionSequence
96-142KSTKKRVHRSKLNRRRKPRNQITFPQSRGKGALKPFSESRTRVSKRR
Subcellular Location(s) nucl 15, mito 11, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKGLRSSVKKANRTKLRSRVFGPVEAARNERLHEKLLELVNAPKPEPRQKPNNMDVDPPKASADVSLPADDTLSTDDKDMPKEMDIDGDAATSAKSTKKRVHRSKLNRRRKPRNQITFPQSRGKGALKPFSESRTRVSKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.82
3 0.83
4 0.81
5 0.78
6 0.73
7 0.72
8 0.65
9 0.6
10 0.54
11 0.49
12 0.45
13 0.42
14 0.4
15 0.34
16 0.31
17 0.29
18 0.29
19 0.25
20 0.23
21 0.22
22 0.21
23 0.22
24 0.22
25 0.22
26 0.19
27 0.21
28 0.23
29 0.23
30 0.23
31 0.21
32 0.24
33 0.32
34 0.38
35 0.41
36 0.46
37 0.53
38 0.61
39 0.65
40 0.68
41 0.6
42 0.58
43 0.55
44 0.51
45 0.44
46 0.37
47 0.3
48 0.22
49 0.2
50 0.15
51 0.13
52 0.1
53 0.1
54 0.09
55 0.09
56 0.09
57 0.09
58 0.08
59 0.07
60 0.07
61 0.07
62 0.07
63 0.08
64 0.1
65 0.11
66 0.12
67 0.13
68 0.12
69 0.11
70 0.12
71 0.11
72 0.1
73 0.1
74 0.09
75 0.08
76 0.07
77 0.07
78 0.06
79 0.06
80 0.05
81 0.06
82 0.09
83 0.13
84 0.18
85 0.26
86 0.36
87 0.48
88 0.58
89 0.67
90 0.74
91 0.82
92 0.89
93 0.92
94 0.93
95 0.93
96 0.93
97 0.94
98 0.94
99 0.94
100 0.93
101 0.93
102 0.91
103 0.9
104 0.88
105 0.86
106 0.8
107 0.77
108 0.68
109 0.59
110 0.54
111 0.48
112 0.46
113 0.43
114 0.47
115 0.4
116 0.44
117 0.45
118 0.46
119 0.5
120 0.46
121 0.45
122 0.47