Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1ZFQ9

Protein Details
Accession A0A1Y1ZFQ9    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
8-47STVRIFEPNRTKRRRLNSACNYCRTRKTRCDEQKPSCHACHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, mito_nucl 14, nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MSLSLHASTVRIFEPNRTKRRRLNSACNYCRTRKTRCDEQKPSCHACLAAGLPCITTDPKRSERHIERREAGKRSGHTKPHSILDHTPGNKDSQGQGEIGGPPGTAVSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.42
3 0.52
4 0.58
5 0.64
6 0.68
7 0.78
8 0.8
9 0.78
10 0.8
11 0.8
12 0.84
13 0.83
14 0.82
15 0.78
16 0.71
17 0.72
18 0.66
19 0.63
20 0.61
21 0.63
22 0.66
23 0.71
24 0.77
25 0.78
26 0.82
27 0.83
28 0.81
29 0.77
30 0.67
31 0.57
32 0.46
33 0.36
34 0.29
35 0.2
36 0.15
37 0.11
38 0.1
39 0.09
40 0.09
41 0.1
42 0.09
43 0.09
44 0.11
45 0.16
46 0.23
47 0.26
48 0.3
49 0.38
50 0.47
51 0.57
52 0.59
53 0.6
54 0.58
55 0.63
56 0.67
57 0.61
58 0.55
59 0.5
60 0.46
61 0.46
62 0.49
63 0.48
64 0.46
65 0.48
66 0.47
67 0.49
68 0.49
69 0.47
70 0.42
71 0.4
72 0.44
73 0.39
74 0.4
75 0.33
76 0.33
77 0.3
78 0.29
79 0.26
80 0.22
81 0.22
82 0.2
83 0.19
84 0.19
85 0.19
86 0.19
87 0.17
88 0.12
89 0.11