Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1ZTR4

Protein Details
Accession A0A1Y1ZTR4    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
31-64IHPHRGAHHNPPRHRRHPRPPRPHPPHPRQESICBasic
NLS Segment(s)
PositionSequence
36-57GAHHNPPRHRRHPRPPRPHPPH
139-154RGRRARREAMHLRLPK
Subcellular Location(s) mito 11, plas 8, nucl 3, cyto 2, pero 1, E.R. 1, golg 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAQELQSKPNHRTSPPSTPSSLRRSLLYQIIHPHRGAHHNPPRHRRHPRPPRPHPPHPRQESICLCTWNVVLLGLDIWAMLEFLFDGYHADGPPILRAYERPMITALWLLIAVLCWRFVLMSWECVDCCVTTSRGGGDRGRRARREAMHLRLPKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.6
3 0.6
4 0.54
5 0.55
6 0.59
7 0.58
8 0.56
9 0.47
10 0.43
11 0.42
12 0.42
13 0.43
14 0.38
15 0.34
16 0.37
17 0.42
18 0.42
19 0.39
20 0.37
21 0.34
22 0.39
23 0.4
24 0.41
25 0.44
26 0.51
27 0.59
28 0.67
29 0.73
30 0.76
31 0.83
32 0.82
33 0.84
34 0.87
35 0.89
36 0.9
37 0.92
38 0.93
39 0.92
40 0.92
41 0.92
42 0.9
43 0.89
44 0.84
45 0.81
46 0.72
47 0.71
48 0.65
49 0.57
50 0.5
51 0.41
52 0.34
53 0.28
54 0.25
55 0.17
56 0.13
57 0.09
58 0.06
59 0.05
60 0.05
61 0.04
62 0.04
63 0.03
64 0.03
65 0.02
66 0.02
67 0.02
68 0.02
69 0.02
70 0.02
71 0.03
72 0.03
73 0.03
74 0.04
75 0.05
76 0.05
77 0.05
78 0.06
79 0.06
80 0.08
81 0.08
82 0.07
83 0.07
84 0.08
85 0.13
86 0.18
87 0.18
88 0.18
89 0.18
90 0.18
91 0.18
92 0.18
93 0.13
94 0.07
95 0.07
96 0.06
97 0.05
98 0.05
99 0.06
100 0.05
101 0.05
102 0.05
103 0.05
104 0.05
105 0.05
106 0.11
107 0.12
108 0.14
109 0.16
110 0.17
111 0.17
112 0.18
113 0.18
114 0.13
115 0.13
116 0.13
117 0.13
118 0.14
119 0.15
120 0.17
121 0.2
122 0.24
123 0.27
124 0.33
125 0.42
126 0.5
127 0.58
128 0.58
129 0.6
130 0.65
131 0.65
132 0.67
133 0.66
134 0.65
135 0.66