Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1YX08

Protein Details
Accession A0A1Y1YX08   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
47-66GPSNKSSKHKARKVWQSVKKHydrophilic
NLS Segment(s)
PositionSequence
53-67SKHKARKVWQSVKKA
Subcellular Location(s) nucl 10.5, mito 10, cyto_nucl 9.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MSSPTPSHTYYPYISPRPSFETNNTFDTTKSDALIDTTTQLVGTQPGPSNKSSKHKARKVWQSVKKAAKEHHRAVNSAYVLYYGGPQFQNPPPSWRDQARIKEEGQGERGLREGQAQGAEVESGLTQTQTQRDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.41
3 0.42
4 0.45
5 0.48
6 0.44
7 0.43
8 0.45
9 0.45
10 0.46
11 0.45
12 0.38
13 0.33
14 0.33
15 0.3
16 0.24
17 0.21
18 0.17
19 0.15
20 0.16
21 0.17
22 0.13
23 0.1
24 0.09
25 0.09
26 0.08
27 0.08
28 0.07
29 0.07
30 0.07
31 0.09
32 0.12
33 0.15
34 0.17
35 0.18
36 0.22
37 0.25
38 0.32
39 0.37
40 0.44
41 0.52
42 0.57
43 0.64
44 0.69
45 0.75
46 0.78
47 0.81
48 0.79
49 0.76
50 0.78
51 0.77
52 0.72
53 0.65
54 0.59
55 0.59
56 0.58
57 0.55
58 0.53
59 0.48
60 0.44
61 0.42
62 0.42
63 0.33
64 0.25
65 0.2
66 0.13
67 0.12
68 0.11
69 0.11
70 0.06
71 0.08
72 0.08
73 0.09
74 0.13
75 0.16
76 0.21
77 0.21
78 0.25
79 0.25
80 0.3
81 0.35
82 0.34
83 0.37
84 0.4
85 0.48
86 0.5
87 0.51
88 0.47
89 0.49
90 0.49
91 0.46
92 0.4
93 0.36
94 0.3
95 0.27
96 0.28
97 0.22
98 0.18
99 0.18
100 0.16
101 0.13
102 0.14
103 0.14
104 0.13
105 0.12
106 0.12
107 0.09
108 0.09
109 0.07
110 0.07
111 0.06
112 0.07
113 0.08
114 0.11