Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1Y2M5

Protein Details
Accession A0A1Y1Y2M5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
4-35AFSIARRRSTPNKPIKPPGKNWARNRHEKFIYHydrophilic
NLS Segment(s)
PositionSequence
10-27RRSTPNKPIKPPGKNWAR
Subcellular Location(s) mito 17.5, mito_nucl 10.5, cyto 4, pero 3
Family & Domain DBs
Amino Acid Sequences SSLAFSIARRRSTPNKPIKPPGKNWARNRHEKFIYNKITEWFEVIKKVLQDPTVLSENAVGLGQGRDDLRNYKGAKFSVERTMVTTVECISADGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.69
3 0.73
4 0.81
5 0.84
6 0.82
7 0.79
8 0.79
9 0.79
10 0.78
11 0.8
12 0.8
13 0.78
14 0.81
15 0.82
16 0.8
17 0.74
18 0.7
19 0.67
20 0.66
21 0.65
22 0.56
23 0.5
24 0.44
25 0.41
26 0.35
27 0.31
28 0.23
29 0.16
30 0.16
31 0.15
32 0.14
33 0.13
34 0.14
35 0.13
36 0.12
37 0.12
38 0.11
39 0.14
40 0.15
41 0.14
42 0.13
43 0.12
44 0.11
45 0.11
46 0.1
47 0.06
48 0.04
49 0.05
50 0.05
51 0.06
52 0.06
53 0.07
54 0.09
55 0.12
56 0.13
57 0.2
58 0.22
59 0.24
60 0.28
61 0.28
62 0.32
63 0.32
64 0.34
65 0.36
66 0.37
67 0.33
68 0.32
69 0.34
70 0.3
71 0.27
72 0.24
73 0.17
74 0.16
75 0.15