Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1ZAT6

Protein Details
Accession A0A1Y1ZAT6    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
8-42GEETTRRTRRERGKSRTQRRRSRCEDNIRVRPRYEBasic
NLS Segment(s)
PositionSequence
13-30RRTRRERGKSRTQRRRSR
137-143RRPKRSS
Subcellular Location(s) nucl 14, cyto_nucl 11, mito 6, cyto 6
Family & Domain DBs
Amino Acid Sequences MPSAPVSGEETTRRTRRERGKSRTQRRRSRCEDNIRVRPRYERGRREEMIISRWAGRWRAVGVEQEALAGALTACGARSEAQTAATALEWKQRRQTTAVNESRQAVLDEWCVGGQTPAAVASHPLGGPDEGLRLGARRPKRSSKDEPASRIEDRRPGAVVVRAAERLDVAVENSGGTVRRAHQKATTAPQNAGDSCAPLAAGQPVSRNASHRIASHRNTGPQRRCRGLETLQEASAPAVRVVQASPKGSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.52
3 0.59
4 0.67
5 0.73
6 0.73
7 0.79
8 0.85
9 0.91
10 0.93
11 0.93
12 0.92
13 0.91
14 0.93
15 0.9
16 0.89
17 0.88
18 0.88
19 0.88
20 0.88
21 0.89
22 0.86
23 0.82
24 0.74
25 0.7
26 0.67
27 0.67
28 0.67
29 0.66
30 0.66
31 0.71
32 0.69
33 0.67
34 0.66
35 0.58
36 0.52
37 0.45
38 0.38
39 0.31
40 0.33
41 0.32
42 0.27
43 0.25
44 0.23
45 0.21
46 0.23
47 0.22
48 0.23
49 0.21
50 0.21
51 0.19
52 0.16
53 0.15
54 0.12
55 0.1
56 0.07
57 0.04
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.04
64 0.05
65 0.06
66 0.08
67 0.08
68 0.09
69 0.1
70 0.1
71 0.1
72 0.09
73 0.1
74 0.08
75 0.15
76 0.16
77 0.18
78 0.25
79 0.26
80 0.28
81 0.31
82 0.36
83 0.37
84 0.45
85 0.51
86 0.46
87 0.45
88 0.44
89 0.41
90 0.36
91 0.28
92 0.19
93 0.13
94 0.11
95 0.1
96 0.09
97 0.08
98 0.08
99 0.07
100 0.06
101 0.04
102 0.04
103 0.03
104 0.03
105 0.04
106 0.04
107 0.04
108 0.05
109 0.06
110 0.06
111 0.06
112 0.06
113 0.06
114 0.06
115 0.06
116 0.06
117 0.05
118 0.05
119 0.05
120 0.05
121 0.07
122 0.13
123 0.18
124 0.24
125 0.3
126 0.39
127 0.46
128 0.53
129 0.6
130 0.65
131 0.7
132 0.69
133 0.68
134 0.64
135 0.62
136 0.56
137 0.51
138 0.43
139 0.39
140 0.34
141 0.31
142 0.27
143 0.22
144 0.22
145 0.21
146 0.2
147 0.15
148 0.16
149 0.15
150 0.14
151 0.14
152 0.12
153 0.09
154 0.08
155 0.07
156 0.06
157 0.06
158 0.06
159 0.06
160 0.06
161 0.06
162 0.06
163 0.07
164 0.08
165 0.1
166 0.2
167 0.21
168 0.23
169 0.26
170 0.31
171 0.36
172 0.42
173 0.48
174 0.41
175 0.41
176 0.42
177 0.42
178 0.36
179 0.34
180 0.26
181 0.19
182 0.17
183 0.16
184 0.12
185 0.09
186 0.1
187 0.09
188 0.1
189 0.1
190 0.12
191 0.15
192 0.19
193 0.2
194 0.22
195 0.25
196 0.29
197 0.3
198 0.32
199 0.37
200 0.42
201 0.45
202 0.51
203 0.5
204 0.54
205 0.61
206 0.67
207 0.69
208 0.7
209 0.75
210 0.72
211 0.7
212 0.66
213 0.63
214 0.6
215 0.59
216 0.57
217 0.52
218 0.46
219 0.43
220 0.4
221 0.34
222 0.3
223 0.22
224 0.15
225 0.12
226 0.12
227 0.13
228 0.14
229 0.2
230 0.23