Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8P1I7

Protein Details
Accession B8P1I7    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
5-26EPPTGKFKSEAQKQRSNKRKVVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, cyto 6, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR017423  TRM6  
Gene Ontology GO:0005634  C:nucleus  
GO:0031515  C:tRNA (m1A) methyltransferase complex  
GO:0003743  F:translation initiation factor activity  
GO:0030488  P:tRNA methylation  
KEGG ppl:POSPLDRAFT_134954  -  
Amino Acid Sequences VASPEPPTGKFKSEAQKQRSNKRKVVAESLSQTREELFAGEFDGLIIASEYDPFSILQSLSPYLAGSASIVVHSPYVQVFSLLFHDFSTLTTCPDCGRFTESATRVASIPWAYRHGSVVTALSVLPGRTHPLMNMSGSGGFILHTTKVSVYAFDLPLLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.61
3 0.68
4 0.72
5 0.8
6 0.83
7 0.82
8 0.78
9 0.76
10 0.76
11 0.71
12 0.72
13 0.65
14 0.61
15 0.58
16 0.58
17 0.52
18 0.44
19 0.39
20 0.3
21 0.26
22 0.2
23 0.15
24 0.09
25 0.08
26 0.08
27 0.08
28 0.07
29 0.06
30 0.06
31 0.05
32 0.04
33 0.04
34 0.03
35 0.03
36 0.04
37 0.05
38 0.04
39 0.05
40 0.05
41 0.06
42 0.07
43 0.07
44 0.07
45 0.08
46 0.09
47 0.08
48 0.08
49 0.07
50 0.06
51 0.06
52 0.06
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.05
62 0.04
63 0.06
64 0.05
65 0.05
66 0.05
67 0.06
68 0.08
69 0.08
70 0.09
71 0.07
72 0.08
73 0.08
74 0.08
75 0.11
76 0.09
77 0.1
78 0.09
79 0.1
80 0.1
81 0.12
82 0.12
83 0.1
84 0.14
85 0.14
86 0.16
87 0.23
88 0.24
89 0.27
90 0.26
91 0.26
92 0.22
93 0.21
94 0.21
95 0.15
96 0.16
97 0.13
98 0.16
99 0.17
100 0.17
101 0.19
102 0.17
103 0.17
104 0.15
105 0.14
106 0.11
107 0.1
108 0.09
109 0.08
110 0.09
111 0.08
112 0.08
113 0.08
114 0.12
115 0.13
116 0.14
117 0.13
118 0.16
119 0.18
120 0.18
121 0.19
122 0.16
123 0.15
124 0.14
125 0.14
126 0.1
127 0.08
128 0.07
129 0.08
130 0.08
131 0.08
132 0.09
133 0.09
134 0.12
135 0.13
136 0.13
137 0.15
138 0.19
139 0.19