Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1YLE5

Protein Details
Accession A0A1Y1YLE5    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-36MPPKTKKPTAKEKPTATKKTTRRSKPIKKWSMYPSLHydrophilic
NLS Segment(s)
PositionSequence
4-29KTKKPTAKEKPTATKKTTRRSKPIKK
Subcellular Location(s) nucl 21.5, mito_nucl 13.833, cyto_nucl 12.166, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR027377  ZAR1/RTP1-5-like_Znf-3CxxC  
Pfam View protein in Pfam  
PF13695  zf-3CxxC  
Amino Acid Sequences MPPKTKKPTAKEKPTATKKTTRRSKPIKKWSMYPSLDDEVSNLLREDNLVFTFHPNDEENTCLNGYDTNVMGRFACRNKNCTAVWTSKQIAITIRRYPNERYNARVYHQSCKRCLMTFKPQLDHESYAERVAYRIKKWCGVKMEAPPFKGRSDGPHRSDLCEGCKQGRCSKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.84
4 0.83
5 0.8
6 0.82
7 0.82
8 0.81
9 0.81
10 0.83
11 0.88
12 0.89
13 0.92
14 0.91
15 0.85
16 0.84
17 0.8
18 0.79
19 0.7
20 0.62
21 0.57
22 0.5
23 0.46
24 0.37
25 0.3
26 0.24
27 0.22
28 0.19
29 0.14
30 0.1
31 0.1
32 0.1
33 0.1
34 0.08
35 0.08
36 0.09
37 0.09
38 0.11
39 0.13
40 0.13
41 0.15
42 0.14
43 0.15
44 0.15
45 0.17
46 0.16
47 0.16
48 0.15
49 0.13
50 0.12
51 0.11
52 0.1
53 0.09
54 0.09
55 0.08
56 0.08
57 0.09
58 0.08
59 0.09
60 0.12
61 0.14
62 0.21
63 0.22
64 0.25
65 0.26
66 0.31
67 0.3
68 0.29
69 0.3
70 0.27
71 0.28
72 0.29
73 0.28
74 0.25
75 0.26
76 0.24
77 0.23
78 0.23
79 0.25
80 0.27
81 0.3
82 0.29
83 0.32
84 0.36
85 0.4
86 0.44
87 0.42
88 0.4
89 0.42
90 0.43
91 0.42
92 0.46
93 0.41
94 0.42
95 0.47
96 0.47
97 0.43
98 0.46
99 0.47
100 0.41
101 0.43
102 0.4
103 0.44
104 0.48
105 0.5
106 0.49
107 0.48
108 0.48
109 0.48
110 0.44
111 0.35
112 0.3
113 0.26
114 0.24
115 0.23
116 0.19
117 0.16
118 0.2
119 0.23
120 0.23
121 0.31
122 0.33
123 0.4
124 0.43
125 0.49
126 0.48
127 0.48
128 0.51
129 0.52
130 0.6
131 0.57
132 0.57
133 0.55
134 0.51
135 0.47
136 0.44
137 0.35
138 0.34
139 0.39
140 0.46
141 0.45
142 0.53
143 0.53
144 0.54
145 0.59
146 0.53
147 0.49
148 0.47
149 0.45
150 0.44
151 0.5
152 0.51