Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2A5P6

Protein Details
Accession A0A1Y2A5P6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
60-79ISRKHPSKARGLHRRGRGSTBasic
NLS Segment(s)
PositionSequence
62-76RKHPSKARGLHRRGR
Subcellular Location(s) extr 14, mito 11
Family & Domain DBs
Amino Acid Sequences MFAFAARLFLAVQARLLAERSRSADGYQPHSRCLLAGFLQPTLLLRRTIMRGKICGVSSISRKHPSKARGLHRRGRGSTGTHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.13
4 0.12
5 0.12
6 0.15
7 0.18
8 0.2
9 0.2
10 0.2
11 0.24
12 0.25
13 0.31
14 0.36
15 0.33
16 0.32
17 0.32
18 0.31
19 0.26
20 0.23
21 0.18
22 0.11
23 0.13
24 0.13
25 0.12
26 0.12
27 0.11
28 0.11
29 0.11
30 0.11
31 0.08
32 0.08
33 0.1
34 0.14
35 0.18
36 0.23
37 0.23
38 0.23
39 0.25
40 0.29
41 0.27
42 0.25
43 0.23
44 0.22
45 0.25
46 0.29
47 0.33
48 0.38
49 0.4
50 0.43
51 0.49
52 0.49
53 0.54
54 0.58
55 0.63
56 0.65
57 0.73
58 0.76
59 0.78
60 0.82
61 0.75
62 0.72
63 0.65