Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8PD05

Protein Details
Accession B8PD05    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGRLRRSRTHHAKRDVHRASRTRBasic
75-94LRAHWRSKVHKRRCKALKEPBasic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
KEGG ppl:POSPLDRAFT_90601  -  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MGRLRRSRTHHAKRDVHRASRTRVRTRDLDQIQSIDLDPKNRAALEAQQLDFDKPGLAQHYCVECAKYFEADAALRAHWRSKVHKRRCKALKEPAYTIEESERAAGLGREGKRPSTTTAIQEDIPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.85
3 0.82
4 0.8
5 0.76
6 0.74
7 0.74
8 0.75
9 0.74
10 0.7
11 0.68
12 0.65
13 0.63
14 0.65
15 0.59
16 0.56
17 0.48
18 0.43
19 0.38
20 0.33
21 0.28
22 0.23
23 0.2
24 0.17
25 0.16
26 0.16
27 0.17
28 0.16
29 0.17
30 0.13
31 0.16
32 0.21
33 0.23
34 0.22
35 0.23
36 0.23
37 0.23
38 0.22
39 0.17
40 0.11
41 0.07
42 0.08
43 0.09
44 0.08
45 0.09
46 0.11
47 0.12
48 0.13
49 0.14
50 0.14
51 0.11
52 0.13
53 0.13
54 0.11
55 0.1
56 0.09
57 0.1
58 0.09
59 0.1
60 0.09
61 0.08
62 0.09
63 0.1
64 0.11
65 0.13
66 0.17
67 0.24
68 0.34
69 0.45
70 0.55
71 0.63
72 0.67
73 0.74
74 0.79
75 0.8
76 0.78
77 0.78
78 0.77
79 0.74
80 0.73
81 0.67
82 0.62
83 0.53
84 0.45
85 0.36
86 0.27
87 0.22
88 0.2
89 0.15
90 0.11
91 0.11
92 0.1
93 0.1
94 0.16
95 0.18
96 0.23
97 0.25
98 0.28
99 0.31
100 0.33
101 0.35
102 0.36
103 0.38
104 0.37
105 0.4
106 0.4