Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1YX58

Protein Details
Accession A0A1Y1YX58   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
23-51AAFRTRGLKNNHTNRKHRRRYNCDHCESAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MPPIKEQPVRDLRESYVCEECGAAFRTRGLKNNHTNRKHRRRYNCDHCESAFALNADLQRHKRTVHKETIPSSSKAFTCPYDGCATPTKKFTRRDNLSRHMVRCLNAQAKPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.43
3 0.37
4 0.33
5 0.29
6 0.26
7 0.24
8 0.2
9 0.21
10 0.18
11 0.14
12 0.16
13 0.23
14 0.25
15 0.32
16 0.34
17 0.4
18 0.49
19 0.6
20 0.67
21 0.69
22 0.76
23 0.81
24 0.85
25 0.87
26 0.86
27 0.86
28 0.86
29 0.89
30 0.9
31 0.88
32 0.82
33 0.75
34 0.66
35 0.58
36 0.49
37 0.39
38 0.29
39 0.2
40 0.15
41 0.13
42 0.14
43 0.11
44 0.13
45 0.15
46 0.15
47 0.16
48 0.18
49 0.23
50 0.29
51 0.35
52 0.4
53 0.44
54 0.48
55 0.49
56 0.56
57 0.53
58 0.47
59 0.42
60 0.36
61 0.3
62 0.27
63 0.26
64 0.2
65 0.21
66 0.2
67 0.21
68 0.22
69 0.22
70 0.23
71 0.29
72 0.32
73 0.3
74 0.37
75 0.41
76 0.45
77 0.52
78 0.59
79 0.62
80 0.67
81 0.74
82 0.76
83 0.77
84 0.8
85 0.79
86 0.72
87 0.69
88 0.63
89 0.55
90 0.51
91 0.52
92 0.49