Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2AAK4

Protein Details
Accession A0A1Y2AAK4    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
14-37DGGNTSKKKKADKKADKGMEKQKEBasic
NLS Segment(s)
PositionSequence
19-46SKKKKADKKADKGMEKQKEVKADKKGRE
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009060  UBA-like_sf  
Pfam View protein in Pfam  
PF14555  UBA_4  
CDD cd14273  UBA_TAP-C_like  
Amino Acid Sequences MPKRKADAAVMEADGGNTSKKKKADKKADKGMEKQKEVKADKKGRERDGGYSTQQKSAISQFMNFTSTDRNTAIRHLKSSGWNQEQAVNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.13
3 0.12
4 0.12
5 0.14
6 0.19
7 0.24
8 0.34
9 0.43
10 0.53
11 0.62
12 0.71
13 0.78
14 0.83
15 0.87
16 0.83
17 0.81
18 0.8
19 0.76
20 0.69
21 0.65
22 0.58
23 0.57
24 0.56
25 0.54
26 0.54
27 0.54
28 0.57
29 0.61
30 0.65
31 0.59
32 0.61
33 0.56
34 0.51
35 0.47
36 0.43
37 0.37
38 0.38
39 0.36
40 0.33
41 0.32
42 0.28
43 0.25
44 0.25
45 0.26
46 0.18
47 0.18
48 0.17
49 0.18
50 0.19
51 0.17
52 0.16
53 0.17
54 0.17
55 0.19
56 0.19
57 0.2
58 0.2
59 0.27
60 0.35
61 0.32
62 0.34
63 0.33
64 0.36
65 0.4
66 0.48
67 0.51
68 0.47
69 0.48
70 0.46