Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8P3X7

Protein Details
Accession B8P3X7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
23-47TPPTRKPDLINRRKRFKSQRMDGVGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 13, cyto 2.5
Family & Domain DBs
KEGG ppl:POSPLDRAFT_93501  -  
Amino Acid Sequences MSRRMSLPLITFPDQRYPHMILTPPTRKPDLINRRKRFKSQRMDGVGEQPTLRLMIDGQHLHPGVVARDCRAYVRKDTGDTARPPRALEVASDARQVALGREVTAKTCTPAWLPGSAGPLSESSLANQRDHRAMGRSPLCAVPCDGQHLHPGLVARVCGASERKLFGETARLLRAGSVGSWLSGLAGPMEETPLAEQQDHCAAGRSPRCAVICDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.41
3 0.41
4 0.38
5 0.37
6 0.37
7 0.38
8 0.34
9 0.42
10 0.47
11 0.46
12 0.48
13 0.48
14 0.45
15 0.46
16 0.52
17 0.54
18 0.57
19 0.63
20 0.67
21 0.75
22 0.8
23 0.85
24 0.85
25 0.84
26 0.84
27 0.82
28 0.83
29 0.8
30 0.79
31 0.7
32 0.67
33 0.59
34 0.49
35 0.39
36 0.29
37 0.23
38 0.18
39 0.16
40 0.09
41 0.06
42 0.08
43 0.13
44 0.14
45 0.14
46 0.19
47 0.19
48 0.18
49 0.19
50 0.17
51 0.14
52 0.16
53 0.16
54 0.13
55 0.14
56 0.15
57 0.17
58 0.2
59 0.21
60 0.22
61 0.28
62 0.29
63 0.29
64 0.32
65 0.34
66 0.36
67 0.37
68 0.39
69 0.37
70 0.36
71 0.34
72 0.32
73 0.29
74 0.23
75 0.19
76 0.19
77 0.18
78 0.18
79 0.19
80 0.17
81 0.16
82 0.16
83 0.16
84 0.1
85 0.08
86 0.08
87 0.08
88 0.09
89 0.1
90 0.1
91 0.12
92 0.11
93 0.1
94 0.1
95 0.1
96 0.09
97 0.12
98 0.12
99 0.11
100 0.12
101 0.12
102 0.15
103 0.14
104 0.13
105 0.11
106 0.1
107 0.1
108 0.11
109 0.1
110 0.08
111 0.15
112 0.16
113 0.17
114 0.18
115 0.2
116 0.2
117 0.21
118 0.22
119 0.18
120 0.18
121 0.24
122 0.25
123 0.24
124 0.23
125 0.25
126 0.24
127 0.21
128 0.22
129 0.16
130 0.14
131 0.19
132 0.18
133 0.17
134 0.19
135 0.2
136 0.18
137 0.18
138 0.18
139 0.14
140 0.14
141 0.13
142 0.1
143 0.09
144 0.09
145 0.1
146 0.12
147 0.14
148 0.15
149 0.18
150 0.18
151 0.19
152 0.2
153 0.18
154 0.23
155 0.22
156 0.24
157 0.24
158 0.23
159 0.22
160 0.22
161 0.22
162 0.15
163 0.11
164 0.11
165 0.09
166 0.09
167 0.09
168 0.09
169 0.09
170 0.08
171 0.09
172 0.06
173 0.06
174 0.07
175 0.07
176 0.08
177 0.07
178 0.07
179 0.09
180 0.12
181 0.14
182 0.14
183 0.14
184 0.16
185 0.21
186 0.22
187 0.2
188 0.2
189 0.2
190 0.28
191 0.33
192 0.34
193 0.31
194 0.36
195 0.37