Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2A1E7

Protein Details
Accession A0A1Y2A1E7   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MLNRKLQKLIRRLSRRNPSGKKHQPPQNDCPRRSHydrophilic
NLS Segment(s)
PositionSequence
11-22RRLSRRNPSGKK
Subcellular Location(s) nucl 14, cyto_nucl 10, mito 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MLNRKLQKLIRRLSRRNPSGKKHQPPQNDCPRRSPRLSSGLYTPRYPQKAENIFQSQLALSRQPTGSRSDGEPNWPLVDPRKSIKYPWRTSSDSEDTCLDRIFRTIDEDIYPGDDEMDIERIVFRQAWAVSLGLAGSFGSYYNGFVHATVVQLCRGDVW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.85
3 0.86
4 0.86
5 0.84
6 0.85
7 0.87
8 0.86
9 0.85
10 0.85
11 0.85
12 0.83
13 0.85
14 0.85
15 0.84
16 0.77
17 0.77
18 0.77
19 0.73
20 0.7
21 0.65
22 0.61
23 0.6
24 0.6
25 0.52
26 0.51
27 0.52
28 0.5
29 0.45
30 0.42
31 0.41
32 0.41
33 0.4
34 0.36
35 0.37
36 0.42
37 0.43
38 0.45
39 0.42
40 0.4
41 0.39
42 0.36
43 0.26
44 0.21
45 0.2
46 0.15
47 0.11
48 0.13
49 0.13
50 0.14
51 0.15
52 0.17
53 0.18
54 0.18
55 0.19
56 0.22
57 0.22
58 0.24
59 0.24
60 0.21
61 0.2
62 0.19
63 0.17
64 0.17
65 0.19
66 0.17
67 0.18
68 0.23
69 0.22
70 0.26
71 0.34
72 0.4
73 0.42
74 0.46
75 0.49
76 0.46
77 0.48
78 0.52
79 0.5
80 0.41
81 0.37
82 0.34
83 0.29
84 0.27
85 0.25
86 0.18
87 0.11
88 0.11
89 0.11
90 0.09
91 0.13
92 0.13
93 0.14
94 0.14
95 0.14
96 0.13
97 0.14
98 0.14
99 0.09
100 0.09
101 0.07
102 0.07
103 0.07
104 0.09
105 0.07
106 0.07
107 0.07
108 0.08
109 0.09
110 0.09
111 0.08
112 0.11
113 0.11
114 0.12
115 0.13
116 0.13
117 0.12
118 0.11
119 0.11
120 0.06
121 0.06
122 0.05
123 0.04
124 0.04
125 0.04
126 0.06
127 0.06
128 0.08
129 0.09
130 0.11
131 0.11
132 0.11
133 0.13
134 0.11
135 0.13
136 0.14
137 0.15
138 0.15
139 0.15