Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2AA61

Protein Details
Accession A0A1Y2AA61    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
100-145GDEPTTPKKTPRKRTAKKQEAGNEADSPSPKKCRPTKGRKASEEAEHydrophilic
NLS Segment(s)
PositionSequence
77-91PKPTPKKKKAAAKAK
106-139PKKTPRKRTAKKQEAGNEADSPSPKKCRPTKGRK
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MSDSNSQGATPTASSQFTERELQILSWAMQSLKSGPPEVDYEKLAVFAGMSNPRSASNAWAKIRTKLMTPSDGTAAPKPTPKKKKAAAKAKDDGSDEANGDEPTTPKKTPRKRTAKKQEAGNEADSPSPKKCRPTKGRKASEEAEAAPVKKEDVVEDEDVAMNSDEAADQKDATDGAKKEDDNNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.2
4 0.21
5 0.24
6 0.21
7 0.21
8 0.21
9 0.2
10 0.2
11 0.19
12 0.17
13 0.13
14 0.14
15 0.12
16 0.12
17 0.13
18 0.14
19 0.16
20 0.17
21 0.17
22 0.16
23 0.18
24 0.22
25 0.24
26 0.23
27 0.2
28 0.19
29 0.18
30 0.18
31 0.16
32 0.12
33 0.09
34 0.07
35 0.11
36 0.14
37 0.15
38 0.14
39 0.15
40 0.16
41 0.17
42 0.17
43 0.18
44 0.21
45 0.28
46 0.3
47 0.36
48 0.37
49 0.39
50 0.42
51 0.38
52 0.32
53 0.31
54 0.33
55 0.3
56 0.3
57 0.28
58 0.25
59 0.26
60 0.25
61 0.21
62 0.2
63 0.18
64 0.21
65 0.25
66 0.33
67 0.42
68 0.44
69 0.5
70 0.55
71 0.64
72 0.69
73 0.75
74 0.73
75 0.71
76 0.72
77 0.66
78 0.61
79 0.52
80 0.43
81 0.34
82 0.27
83 0.19
84 0.14
85 0.13
86 0.1
87 0.09
88 0.09
89 0.07
90 0.1
91 0.13
92 0.14
93 0.2
94 0.29
95 0.39
96 0.49
97 0.59
98 0.68
99 0.73
100 0.84
101 0.89
102 0.9
103 0.86
104 0.84
105 0.8
106 0.75
107 0.69
108 0.6
109 0.51
110 0.41
111 0.37
112 0.3
113 0.25
114 0.23
115 0.25
116 0.25
117 0.33
118 0.39
119 0.48
120 0.58
121 0.66
122 0.74
123 0.79
124 0.86
125 0.82
126 0.82
127 0.74
128 0.68
129 0.6
130 0.49
131 0.44
132 0.36
133 0.31
134 0.26
135 0.24
136 0.19
137 0.17
138 0.16
139 0.12
140 0.14
141 0.18
142 0.18
143 0.18
144 0.19
145 0.18
146 0.18
147 0.18
148 0.14
149 0.09
150 0.08
151 0.07
152 0.07
153 0.07
154 0.09
155 0.09
156 0.09
157 0.09
158 0.1
159 0.1
160 0.12
161 0.18
162 0.16
163 0.21
164 0.26
165 0.27