Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1ZUB0

Protein Details
Accession A0A1Y1ZUB0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-28APAATGGKKQKKKWSKGKVKDKANHAVVHydrophilic
NLS Segment(s)
PositionSequence
7-22GKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 19.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences APAATGGKKQKKKWSKGKVKDKANHAVVLDKAISDKLQKDVQSYRLITVAVLVDRLKINGSLARKALNDLEEKGVIKKVVGHSKLSIYSTFPAFLLGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.86
3 0.89
4 0.93
5 0.92
6 0.92
7 0.88
8 0.85
9 0.83
10 0.75
11 0.67
12 0.56
13 0.49
14 0.39
15 0.34
16 0.27
17 0.17
18 0.14
19 0.12
20 0.12
21 0.1
22 0.11
23 0.13
24 0.16
25 0.17
26 0.2
27 0.22
28 0.25
29 0.28
30 0.27
31 0.25
32 0.22
33 0.21
34 0.17
35 0.15
36 0.12
37 0.07
38 0.07
39 0.06
40 0.07
41 0.07
42 0.07
43 0.07
44 0.06
45 0.07
46 0.1
47 0.12
48 0.14
49 0.15
50 0.17
51 0.17
52 0.18
53 0.19
54 0.18
55 0.18
56 0.18
57 0.2
58 0.19
59 0.19
60 0.19
61 0.2
62 0.17
63 0.15
64 0.18
65 0.23
66 0.3
67 0.32
68 0.33
69 0.33
70 0.37
71 0.4
72 0.37
73 0.31
74 0.25
75 0.26
76 0.24
77 0.23
78 0.19