Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1ZSF0

Protein Details
Accession A0A1Y1ZSF0    Localization Confidence Low Confidence Score 5.3
NoLS Segment(s)
PositionSequenceProtein Nature
18-43GSEYPNCTKNSKKPKWKLHDIHYNGPHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 23, nucl 1, mito 1, cyto 1, cyto_nucl 1, vacu 1, cyto_mito 1, mito_nucl 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR032382  AltA1  
Gene Ontology GO:0005576  C:extracellular region  
Pfam View protein in Pfam  
PF16541  AltA1  
Amino Acid Sequences MQYFLLTLALLPLLVQSGSEYPNCTKNSKKPKWKLHDIHYNGPLAWTDAVITPPKQTVPGHVSFTLSSNVVDFTADCSASTSSPFNGSVWYPCKMPASAIPSDKAWFKFDKKYRVMELNQTYTCWESLGPTLVTYFAYGRGRAYINNCYPYDIHGPTPNDSIPGEDCLPVDANITASEISAIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.06
4 0.08
5 0.1
6 0.12
7 0.15
8 0.16
9 0.24
10 0.27
11 0.29
12 0.34
13 0.42
14 0.53
15 0.6
16 0.69
17 0.72
18 0.81
19 0.86
20 0.9
21 0.88
22 0.86
23 0.87
24 0.82
25 0.79
26 0.72
27 0.64
28 0.52
29 0.45
30 0.36
31 0.26
32 0.2
33 0.12
34 0.09
35 0.08
36 0.1
37 0.12
38 0.12
39 0.12
40 0.12
41 0.13
42 0.15
43 0.14
44 0.18
45 0.22
46 0.25
47 0.27
48 0.26
49 0.27
50 0.25
51 0.26
52 0.22
53 0.16
54 0.13
55 0.09
56 0.09
57 0.08
58 0.08
59 0.06
60 0.07
61 0.08
62 0.08
63 0.07
64 0.08
65 0.09
66 0.09
67 0.1
68 0.09
69 0.08
70 0.1
71 0.1
72 0.09
73 0.09
74 0.1
75 0.12
76 0.14
77 0.15
78 0.14
79 0.14
80 0.16
81 0.15
82 0.15
83 0.15
84 0.18
85 0.2
86 0.21
87 0.21
88 0.2
89 0.21
90 0.23
91 0.2
92 0.18
93 0.18
94 0.2
95 0.29
96 0.34
97 0.43
98 0.44
99 0.46
100 0.48
101 0.51
102 0.5
103 0.49
104 0.48
105 0.45
106 0.42
107 0.38
108 0.35
109 0.29
110 0.27
111 0.18
112 0.13
113 0.08
114 0.1
115 0.12
116 0.11
117 0.1
118 0.1
119 0.11
120 0.11
121 0.1
122 0.09
123 0.11
124 0.13
125 0.13
126 0.14
127 0.16
128 0.17
129 0.19
130 0.23
131 0.27
132 0.3
133 0.35
134 0.35
135 0.35
136 0.34
137 0.35
138 0.37
139 0.3
140 0.29
141 0.3
142 0.32
143 0.33
144 0.35
145 0.31
146 0.27
147 0.25
148 0.25
149 0.2
150 0.21
151 0.2
152 0.18
153 0.18
154 0.18
155 0.19
156 0.17
157 0.16
158 0.12
159 0.12
160 0.12
161 0.13
162 0.11
163 0.09