Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1ZVY0

Protein Details
Accession A0A1Y1ZVY0   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
79-107FPNSRKRLWMWRSRLRKSKANIRWGRRLRHydrophilic
NLS Segment(s)
PositionSequence
83-107RKRLWMWRSRLRKSKANIRWGRRLR
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, cyto 6.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012349  Split_barrel_FMN-bd  
IPR007396  TR_PAI2-type  
Pfam View protein in Pfam  
PF04299  FMN_bind_2  
Amino Acid Sequences MSSTIGIGWRSKSAESDISKLYPLIKQNPLGILTTNIPEHASADSSSPVLQSTFIPFILDTPSPAESEAGKLGSLRALFPNSRKRLWMWRSRLRKSKANIRWGRRLRWGPVGDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.31
4 0.31
5 0.3
6 0.3
7 0.28
8 0.26
9 0.22
10 0.24
11 0.27
12 0.29
13 0.3
14 0.31
15 0.33
16 0.32
17 0.29
18 0.24
19 0.2
20 0.17
21 0.16
22 0.14
23 0.12
24 0.11
25 0.11
26 0.11
27 0.09
28 0.09
29 0.08
30 0.09
31 0.09
32 0.09
33 0.09
34 0.08
35 0.08
36 0.06
37 0.07
38 0.06
39 0.08
40 0.09
41 0.09
42 0.09
43 0.08
44 0.09
45 0.1
46 0.1
47 0.08
48 0.09
49 0.1
50 0.09
51 0.1
52 0.1
53 0.08
54 0.09
55 0.1
56 0.08
57 0.07
58 0.07
59 0.07
60 0.09
61 0.09
62 0.08
63 0.1
64 0.12
65 0.14
66 0.21
67 0.31
68 0.33
69 0.34
70 0.35
71 0.37
72 0.44
73 0.51
74 0.55
75 0.55
76 0.6
77 0.69
78 0.77
79 0.83
80 0.79
81 0.78
82 0.76
83 0.78
84 0.77
85 0.78
86 0.78
87 0.76
88 0.8
89 0.79
90 0.78
91 0.77
92 0.75
93 0.7
94 0.7