Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1ZR52

Protein Details
Accession A0A1Y1ZR52    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-32ESKNSSQHNQSKKNHKNGIKKPKTNRYPSLKGHydrophilic
NLS Segment(s)
PositionSequence
12-40KKNHKNGIKKPKTNRYPSLKGTDPKFRRN
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences ESKNSSQHNQSKKNHKNGIKKPKTNRYPSLKGTDPKFRRNHRHALHGTMRALVRQGGQAGRTDMSDEGGFSHSTMRHFAGVNGIRTPKVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.85
4 0.85
5 0.88
6 0.87
7 0.87
8 0.87
9 0.88
10 0.89
11 0.86
12 0.85
13 0.82
14 0.79
15 0.75
16 0.72
17 0.67
18 0.62
19 0.58
20 0.6
21 0.55
22 0.57
23 0.6
24 0.61
25 0.65
26 0.66
27 0.72
28 0.64
29 0.69
30 0.62
31 0.61
32 0.57
33 0.5
34 0.45
35 0.37
36 0.34
37 0.25
38 0.24
39 0.17
40 0.13
41 0.1
42 0.12
43 0.1
44 0.11
45 0.12
46 0.13
47 0.12
48 0.12
49 0.12
50 0.1
51 0.11
52 0.11
53 0.09
54 0.09
55 0.11
56 0.11
57 0.09
58 0.13
59 0.13
60 0.14
61 0.17
62 0.17
63 0.17
64 0.18
65 0.18
66 0.24
67 0.28
68 0.29
69 0.31
70 0.32