Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1ZFK9

Protein Details
Accession A0A1Y1ZFK9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
84-106SSVSHSKKPKPSFTRSPKPTPTGHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 21, mito 3, golg 2
Family & Domain DBs
Amino Acid Sequences MKFSAVLIALGAASIVSALPQVLPSGLPKPSGPPKPTGGLPSFSLPSFPSHTPHSKPTGLPTPPPKPTGLPPVPTGLPPKPSHSSVSHSKKPKPSFTRSPKPTPTGDEEEEGDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.02
4 0.03
5 0.03
6 0.03
7 0.04
8 0.04
9 0.05
10 0.05
11 0.08
12 0.11
13 0.12
14 0.13
15 0.13
16 0.19
17 0.27
18 0.35
19 0.35
20 0.36
21 0.38
22 0.4
23 0.41
24 0.4
25 0.33
26 0.28
27 0.27
28 0.25
29 0.23
30 0.2
31 0.19
32 0.15
33 0.15
34 0.17
35 0.16
36 0.16
37 0.2
38 0.25
39 0.26
40 0.29
41 0.31
42 0.29
43 0.29
44 0.3
45 0.34
46 0.3
47 0.32
48 0.36
49 0.37
50 0.38
51 0.4
52 0.36
53 0.31
54 0.33
55 0.38
56 0.34
57 0.31
58 0.29
59 0.31
60 0.3
61 0.3
62 0.31
63 0.24
64 0.26
65 0.25
66 0.3
67 0.31
68 0.32
69 0.35
70 0.33
71 0.37
72 0.41
73 0.49
74 0.51
75 0.55
76 0.6
77 0.65
78 0.69
79 0.74
80 0.72
81 0.72
82 0.75
83 0.78
84 0.82
85 0.8
86 0.83
87 0.8
88 0.77
89 0.72
90 0.67
91 0.64
92 0.61
93 0.56
94 0.49