Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1ZSJ2

Protein Details
Accession A0A1Y1ZSJ2    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
15-41LLWKIPWRLSRHQKYRQRNRLRHVDSVHydrophilic
77-103KYTVFDRKVKRYRKGIHKVPKWTRVSQHydrophilic
NLS Segment(s)
PositionSequence
85-94VKRYRKGIHK
Subcellular Location(s) mito 20, cyto 3.5, cyto_nucl 3.5, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRLTNPLSGGLLWKIPWRLSRHQKYRQRNRLRHVDSVISTVEAALGRQSKTIRKVEMWKAEMPVEQEMLPKDKYTVFDRKVKRYRKGIHKVPKWTRVSQRLNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.17
5 0.17
6 0.19
7 0.25
8 0.29
9 0.38
10 0.48
11 0.58
12 0.64
13 0.72
14 0.8
15 0.85
16 0.9
17 0.91
18 0.91
19 0.88
20 0.86
21 0.87
22 0.82
23 0.76
24 0.68
25 0.61
26 0.5
27 0.44
28 0.37
29 0.26
30 0.2
31 0.14
32 0.12
33 0.08
34 0.07
35 0.07
36 0.08
37 0.08
38 0.1
39 0.12
40 0.15
41 0.2
42 0.23
43 0.23
44 0.24
45 0.31
46 0.36
47 0.42
48 0.42
49 0.38
50 0.36
51 0.36
52 0.34
53 0.29
54 0.22
55 0.16
56 0.13
57 0.13
58 0.13
59 0.15
60 0.15
61 0.13
62 0.13
63 0.14
64 0.17
65 0.21
66 0.3
67 0.31
68 0.39
69 0.45
70 0.55
71 0.62
72 0.68
73 0.71
74 0.72
75 0.77
76 0.8
77 0.84
78 0.84
79 0.85
80 0.85
81 0.88
82 0.87
83 0.87
84 0.82
85 0.8
86 0.8
87 0.79
88 0.8
89 0.77
90 0.79