Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1Y7Y6

Protein Details
Accession A0A1Y1Y7Y6    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-31GMLIRRQPLRRKAKEPTTVPHydrophilic
33-55TLPATRPKKEVEKPNPKQKTKTFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 12, cyto 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR028020  ASX_DEUBAD_dom  
Pfam View protein in Pfam  
PF13919  ASXH  
Amino Acid Sequences MTDSPDELRNTGMLIRRQPLRRKAKEPTTVPNTLPATRPKKEVEKPNPKQKTKTFDPTYMTTNSRSKLASEGLDIYHLLTKYLAWDILSPDQQAKLLKLLPQFAANLELQEQLKAGGTKVPRAKELSLGFSPFKTDDKAEKAYMARAEGEFDEWKEKEAELWWGQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.33
3 0.39
4 0.47
5 0.56
6 0.62
7 0.67
8 0.7
9 0.73
10 0.78
11 0.8
12 0.81
13 0.77
14 0.77
15 0.73
16 0.68
17 0.61
18 0.59
19 0.52
20 0.44
21 0.43
22 0.42
23 0.43
24 0.41
25 0.45
26 0.42
27 0.48
28 0.54
29 0.61
30 0.63
31 0.67
32 0.73
33 0.8
34 0.86
35 0.8
36 0.81
37 0.76
38 0.74
39 0.7
40 0.71
41 0.65
42 0.6
43 0.6
44 0.55
45 0.52
46 0.47
47 0.41
48 0.34
49 0.33
50 0.29
51 0.26
52 0.24
53 0.21
54 0.2
55 0.2
56 0.16
57 0.14
58 0.14
59 0.12
60 0.13
61 0.12
62 0.1
63 0.1
64 0.09
65 0.08
66 0.07
67 0.07
68 0.07
69 0.08
70 0.07
71 0.05
72 0.06
73 0.08
74 0.1
75 0.11
76 0.11
77 0.11
78 0.11
79 0.12
80 0.12
81 0.11
82 0.1
83 0.11
84 0.14
85 0.15
86 0.17
87 0.16
88 0.16
89 0.16
90 0.14
91 0.16
92 0.13
93 0.11
94 0.1
95 0.12
96 0.11
97 0.11
98 0.1
99 0.08
100 0.1
101 0.1
102 0.09
103 0.11
104 0.12
105 0.19
106 0.24
107 0.25
108 0.26
109 0.3
110 0.31
111 0.34
112 0.35
113 0.34
114 0.31
115 0.33
116 0.31
117 0.27
118 0.29
119 0.23
120 0.22
121 0.19
122 0.2
123 0.23
124 0.28
125 0.32
126 0.3
127 0.33
128 0.32
129 0.34
130 0.33
131 0.29
132 0.25
133 0.21
134 0.23
135 0.2
136 0.22
137 0.19
138 0.19
139 0.24
140 0.22
141 0.24
142 0.22
143 0.22
144 0.2
145 0.2
146 0.26