Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8P356

Protein Details
Accession B8P356   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
158-186APKEPVSKRQEKLRKRGERGDQRVRMQSVHydrophilic
NLS Segment(s)
PositionSequence
161-177EPVSKRQEKLRKRGERG
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR008506  SND2/TMEM208  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
KEGG ppl:POSPLDRAFT_119143  -  
Pfam View protein in Pfam  
PF05620  TMEM208_SND2  
Amino Acid Sequences MANASAKRVAQQNAQTIKNMKYGTLAAGALSLLLRMLFRKGSLSPAKLSLWLLALSNLPSIFLSRYLERIGSPRRDATTDTLISAGEDLGRPGIIEWAFDVIYITWACQVGSGVFGDWFWWLYLVIPLYAVYKLWTSAISPLLFGRPAATPDPRGDSAPKEPVSKRQEKLRKRGERGDQRVRMQSVKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.5
3 0.48
4 0.48
5 0.47
6 0.41
7 0.32
8 0.28
9 0.27
10 0.24
11 0.23
12 0.19
13 0.13
14 0.13
15 0.12
16 0.1
17 0.08
18 0.06
19 0.04
20 0.04
21 0.04
22 0.05
23 0.07
24 0.08
25 0.08
26 0.11
27 0.12
28 0.2
29 0.25
30 0.27
31 0.27
32 0.3
33 0.3
34 0.29
35 0.29
36 0.21
37 0.17
38 0.15
39 0.13
40 0.11
41 0.11
42 0.1
43 0.1
44 0.09
45 0.08
46 0.08
47 0.08
48 0.08
49 0.09
50 0.11
51 0.1
52 0.12
53 0.13
54 0.13
55 0.13
56 0.18
57 0.23
58 0.25
59 0.27
60 0.28
61 0.28
62 0.29
63 0.3
64 0.28
65 0.28
66 0.24
67 0.22
68 0.19
69 0.18
70 0.16
71 0.14
72 0.1
73 0.05
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.06
81 0.05
82 0.05
83 0.05
84 0.07
85 0.07
86 0.07
87 0.07
88 0.04
89 0.06
90 0.06
91 0.06
92 0.06
93 0.06
94 0.06
95 0.06
96 0.06
97 0.05
98 0.05
99 0.06
100 0.05
101 0.05
102 0.05
103 0.05
104 0.05
105 0.06
106 0.05
107 0.05
108 0.05
109 0.05
110 0.07
111 0.07
112 0.07
113 0.06
114 0.07
115 0.08
116 0.08
117 0.07
118 0.07
119 0.07
120 0.07
121 0.08
122 0.08
123 0.07
124 0.1
125 0.14
126 0.13
127 0.13
128 0.13
129 0.14
130 0.14
131 0.13
132 0.12
133 0.1
134 0.13
135 0.16
136 0.18
137 0.19
138 0.21
139 0.27
140 0.27
141 0.28
142 0.28
143 0.3
144 0.33
145 0.38
146 0.38
147 0.38
148 0.39
149 0.46
150 0.53
151 0.57
152 0.56
153 0.59
154 0.66
155 0.7
156 0.79
157 0.8
158 0.81
159 0.81
160 0.86
161 0.86
162 0.87
163 0.87
164 0.88
165 0.85
166 0.81
167 0.81
168 0.75