Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1ZZN2

Protein Details
Accession A0A1Y1ZZN2    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
29-58GREYRTKRGLHKHKYNCHRRSGKKGRYVYTBasic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR013087  Znf_C2H2_type  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences MYMRLNYNITRKSYDTPEGPDERICKACGREYRTKRGLHKHKYNCHRRSGKKGRYVYTHIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.39
3 0.38
4 0.41
5 0.4
6 0.38
7 0.37
8 0.33
9 0.31
10 0.3
11 0.26
12 0.22
13 0.21
14 0.26
15 0.29
16 0.34
17 0.41
18 0.45
19 0.53
20 0.56
21 0.6
22 0.61
23 0.65
24 0.69
25 0.69
26 0.74
27 0.75
28 0.79
29 0.84
30 0.88
31 0.83
32 0.83
33 0.84
34 0.81
35 0.82
36 0.84
37 0.83
38 0.82
39 0.84
40 0.8
41 0.77