Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1ZB68

Protein Details
Accession A0A1Y1ZB68   
Localization Confidence High
Confidence Score 18.2
NoLS Segment(s)
PositionSequenceProtein Nature
29-58APPVRRSNTAPTRHRKPRRIPQDTNSNPQSHydrophilic
307-328EEEKKASSVRSQRRKLEKITAGHydrophilic
NLS Segment(s)
PositionSequence
41-46RHRKPR
71-72RP
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MQGPNMEHQRVDSGFDNSYFSKRPSSTDAPPVRRSNTAPTRHRKPRRIPQDTNSNPQSPEPENHRPASEKRPRRSGEPCRKSVGSSSEHSTTRSRKQGTGSKPSSRRTSVTIVDPTRPTRQYRIKSSQTVPTTNRDVDDVLALHFRSCSLFHNPTYSTGQHLDHRGTNVSGYGTTDADTISSHRFEVSAPTSAPQPQSSLDAILPSESPKQSEDFIMDTVELPTTIMHWTSPTTRQREYEKIDRANSGIRGLLRRIVPRCVSGPPPPKFYEKDASDAGSVRRYRMDIDVDVSESKQHDKEDDVTVVEEEKKASSVRSQRRKLEKITAGSGAGIKKRWACF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.28
4 0.24
5 0.28
6 0.27
7 0.26
8 0.3
9 0.29
10 0.33
11 0.38
12 0.43
13 0.44
14 0.52
15 0.6
16 0.6
17 0.66
18 0.68
19 0.63
20 0.61
21 0.58
22 0.58
23 0.58
24 0.6
25 0.62
26 0.66
27 0.73
28 0.8
29 0.87
30 0.87
31 0.88
32 0.89
33 0.9
34 0.91
35 0.89
36 0.86
37 0.87
38 0.83
39 0.81
40 0.75
41 0.67
42 0.58
43 0.51
44 0.48
45 0.41
46 0.4
47 0.4
48 0.44
49 0.46
50 0.47
51 0.48
52 0.47
53 0.49
54 0.54
55 0.56
56 0.56
57 0.58
58 0.66
59 0.66
60 0.69
61 0.74
62 0.74
63 0.75
64 0.74
65 0.71
66 0.68
67 0.66
68 0.6
69 0.55
70 0.5
71 0.42
72 0.37
73 0.37
74 0.36
75 0.36
76 0.37
77 0.37
78 0.37
79 0.4
80 0.45
81 0.44
82 0.42
83 0.49
84 0.55
85 0.57
86 0.61
87 0.6
88 0.61
89 0.64
90 0.66
91 0.65
92 0.6
93 0.54
94 0.48
95 0.47
96 0.41
97 0.4
98 0.42
99 0.38
100 0.39
101 0.39
102 0.38
103 0.39
104 0.39
105 0.36
106 0.38
107 0.45
108 0.48
109 0.55
110 0.6
111 0.6
112 0.63
113 0.64
114 0.63
115 0.58
116 0.56
117 0.49
118 0.45
119 0.43
120 0.37
121 0.34
122 0.27
123 0.24
124 0.18
125 0.17
126 0.12
127 0.09
128 0.1
129 0.09
130 0.08
131 0.08
132 0.08
133 0.07
134 0.08
135 0.1
136 0.15
137 0.19
138 0.19
139 0.23
140 0.23
141 0.26
142 0.28
143 0.25
144 0.21
145 0.2
146 0.21
147 0.21
148 0.22
149 0.21
150 0.19
151 0.19
152 0.18
153 0.15
154 0.14
155 0.12
156 0.1
157 0.08
158 0.07
159 0.07
160 0.07
161 0.07
162 0.07
163 0.06
164 0.06
165 0.06
166 0.07
167 0.07
168 0.08
169 0.07
170 0.07
171 0.08
172 0.08
173 0.12
174 0.12
175 0.13
176 0.13
177 0.13
178 0.15
179 0.16
180 0.18
181 0.14
182 0.13
183 0.11
184 0.14
185 0.14
186 0.14
187 0.12
188 0.11
189 0.11
190 0.1
191 0.1
192 0.08
193 0.12
194 0.11
195 0.12
196 0.12
197 0.13
198 0.14
199 0.14
200 0.14
201 0.12
202 0.12
203 0.12
204 0.11
205 0.1
206 0.1
207 0.09
208 0.07
209 0.06
210 0.05
211 0.06
212 0.06
213 0.06
214 0.05
215 0.06
216 0.08
217 0.11
218 0.2
219 0.26
220 0.3
221 0.33
222 0.37
223 0.42
224 0.48
225 0.52
226 0.53
227 0.54
228 0.55
229 0.54
230 0.51
231 0.47
232 0.44
233 0.38
234 0.3
235 0.24
236 0.2
237 0.21
238 0.21
239 0.24
240 0.23
241 0.28
242 0.3
243 0.33
244 0.33
245 0.34
246 0.35
247 0.34
248 0.35
249 0.38
250 0.46
251 0.43
252 0.48
253 0.48
254 0.51
255 0.5
256 0.51
257 0.51
258 0.43
259 0.44
260 0.4
261 0.39
262 0.35
263 0.34
264 0.3
265 0.28
266 0.27
267 0.24
268 0.24
269 0.23
270 0.24
271 0.26
272 0.29
273 0.23
274 0.25
275 0.25
276 0.25
277 0.25
278 0.23
279 0.22
280 0.19
281 0.21
282 0.2
283 0.2
284 0.19
285 0.22
286 0.26
287 0.28
288 0.28
289 0.26
290 0.24
291 0.24
292 0.24
293 0.22
294 0.19
295 0.15
296 0.14
297 0.15
298 0.14
299 0.16
300 0.22
301 0.31
302 0.41
303 0.51
304 0.59
305 0.67
306 0.77
307 0.82
308 0.8
309 0.8
310 0.78
311 0.73
312 0.69
313 0.62
314 0.52
315 0.47
316 0.44
317 0.38
318 0.33
319 0.3
320 0.29