Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8PP85

Protein Details
Accession B8PP85    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
54-75SEEPSAKKKRVSRPKVRAQSTSHydrophilic
NLS Segment(s)
PositionSequence
59-69AKKKRVSRPKV
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003173  PC4_C  
IPR009044  ssDNA-bd_transcriptional_reg  
IPR045125  Sub1/Tcp4-like  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0003713  F:transcription coactivator activity  
GO:0060261  P:positive regulation of transcription initiation by RNA polymerase II  
KEGG ppl:POSPLDRAFT_99377  -  
Pfam View protein in Pfam  
PF02229  PC4  
Amino Acid Sequences MGTRAKAKVISSEESDKHHAQSDSEQSEQPLKRTNSVKSMKNKRPAHDDEEGESEEPSAKKKRVSRPKVRAQSTSKGAADDADQQIISVKVNDEGDKYIDLGKKRRATVRAFKGTVFLDIREYYGQEGDEKPGKKGVTLNQEQWEKLKEGQDAIDALFKKTKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.48
3 0.42
4 0.38
5 0.4
6 0.35
7 0.3
8 0.34
9 0.38
10 0.36
11 0.37
12 0.36
13 0.32
14 0.39
15 0.39
16 0.35
17 0.35
18 0.32
19 0.37
20 0.41
21 0.43
22 0.45
23 0.5
24 0.55
25 0.57
26 0.66
27 0.67
28 0.73
29 0.75
30 0.69
31 0.72
32 0.7
33 0.66
34 0.61
35 0.55
36 0.47
37 0.45
38 0.41
39 0.33
40 0.27
41 0.21
42 0.17
43 0.15
44 0.17
45 0.18
46 0.19
47 0.24
48 0.32
49 0.42
50 0.51
51 0.61
52 0.68
53 0.73
54 0.81
55 0.85
56 0.81
57 0.79
58 0.73
59 0.7
60 0.62
61 0.57
62 0.47
63 0.38
64 0.33
65 0.26
66 0.21
67 0.19
68 0.15
69 0.11
70 0.1
71 0.1
72 0.11
73 0.1
74 0.09
75 0.05
76 0.05
77 0.07
78 0.08
79 0.08
80 0.09
81 0.09
82 0.1
83 0.1
84 0.1
85 0.13
86 0.15
87 0.18
88 0.22
89 0.29
90 0.33
91 0.36
92 0.41
93 0.43
94 0.47
95 0.54
96 0.59
97 0.6
98 0.56
99 0.53
100 0.51
101 0.46
102 0.43
103 0.34
104 0.24
105 0.19
106 0.18
107 0.2
108 0.17
109 0.17
110 0.13
111 0.13
112 0.13
113 0.12
114 0.13
115 0.16
116 0.22
117 0.22
118 0.23
119 0.26
120 0.26
121 0.25
122 0.29
123 0.32
124 0.36
125 0.41
126 0.45
127 0.48
128 0.51
129 0.5
130 0.48
131 0.44
132 0.37
133 0.36
134 0.35
135 0.29
136 0.28
137 0.29
138 0.28
139 0.25
140 0.23
141 0.25
142 0.21
143 0.21